Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000055110 (A630012P03Rik)
Chromosomal location
Chr X: 49929020 - 49972224 (+)
Description
RIKEN cDNA A630012P03 gene Gene [Source:MGI Symbol;Acc:MGI:2442968]
MGI
MGI:2442968 
Uniprot/SPTREMBL
Q8C9S7 
Human Ortholog
not available
Omim not available
UniTrap UNI34488
Vector Insertion
Chr X: 49947470 - 49970815
Public Clones IST11978E11 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000114854
Sequence
AGTCTCTCGGTGCCTATTTATGAAGGAAGTTCCCGATGACCCTGCAACTCACAATCATTTCCACCCCATATCCGCTTGCTTATTTTCTCTCATTCAGAAG

GATCTGAGGCCAGTTGACCTGGCCTGGAGGCTGTATCCATAACCATTGCACTGCATTGCAGAAGTGGGGAGCAAAGGCGATGAAGAAGGGGAGACTCAGC

TGTGCCTTTGCTGGTATTCTAGCTGAGAACTGATGGAGACTGGAACTGAAATACAACATCAGATGATGAATGAGACAACTGAGCCTGG AAGACAACACT

GAAGCCTGGAGACAGAGGTGGGAAGAATCTCATTGCAATTGTCCTCCAAGACATTG GAGTGGAAACTGATTCAGTCTACTGGACCAAGAAGGAAAAGAG

CCCCCTTGAGGAAGAGTGGCTGATCTAAATGTAAACAAG AGATGTTTCTGGCTTACAAATCTCCCTGTTGCTAGTATTGCAGCAAATCACAAAGAGGTG

GGAAGCTGCAGCACACCAAAAGTGCACCATCACCTTGATCCCGCAGATCCTGTGAAAAGGCTTTTCAG - UNI34488 - AAGCAACTGTCTCGCCTC

ATTCGAGACAAGCTCCCTTCCTCGTGCTCCGTTTTTGTCAGTGATTCCTCTGAACTCTTCAGTAAGAGAAGCAGAGAGGTAATCAGTGTGGGGCTACAAA

AGGACATGCTGATTGAAAGAGTGTTCGTTCGCCTTGGACAATCATGGCTCTGTGCTCTCAGACCCAGTTGAAAGTGTTTAGATAGCATGGCTGGACCCCC

TTTTCTCCTTTGGACCCCAGGGGAAGGCTATCTAGCCCAGCATGCCCAGAAGAACTTTTCTTCACCTTTTGCTCCTGGACTCCAGTTTGAAAGAATTCGA

GAATTCCCAGCTGTAGCCAGCAGCTATTATCTTGCTGTAGCAGGGAGGAGAGTCTGGTTCCATGGCTCCAAAAGCAGCATAAATCAAGATTTCTGGGAGA

GGGTTAAGAAAGGGTGTTCAACAGCTGCCGCCATGGGAGGAGCGCATACACAGCCATGCACATGGCCACACACACACACATTATTTGTCTTGGGCCCAGT

TCCTTTGCCCCCCAGGTGTTGTTCTCCTTTTTCCATCCCTCTCAGGTACACAGTGTCTTCTGCTCTTAACCTCACTCTCGAACTTGCTGTCAGGGAAGAA

GCTGACAAACTCATCCTATCTCAATGTATCTGGTTGATAGGATGTAATGGGGGCTGCCCACCCAGGGGTATAAGTATTTCAACAGGGATCAAAGCTTTAA

ACCAAAGGAACAGAGCTCTAAAAACTCTGGAATTCCAGGCATCCGCCAGTGGGAAGGGAGTGTTTAAACTGAGGGGCAATGAGGCCTTTTTTGGTGCACC

TGAAATCACATCATGTAGACAGTTGCTTATATGTTAGGCTGCTTGCTGCTCACAGTCAACACCTCTTGTGCCACACCTCTGAGCTAGATGGCACACAGCC

ACTTTGTCTCCTCTTCCCTTGCACTGTATGAGTCCTTTGTGGGCCAGAGGGAAGGGGAGGCGCCAGGCACACTGATCCCAATTCTCCCAGATGTATAAGC

TATGATCAGAGGATGAATTATAGTCCTTTGGGAAAGAGTGTTCATTCATCCATCGCAGCCAGCAGGCCAGTGCAATGTAAATGGTAACTTTGTAAGTTGA

AAGACTTAAAGCCATTTTGAAAATTGCATAATAATCTCAGGCAGAATTTGGCTCCATGTATGTGGAAAATTAATAGATGTGACTGGGATGCTTGCATTGT

GAGTTGTGGAGGGCTAACCTCACTTCAGACTTGAGACTATGCTCTGCCCTCACTAAATCCACAAAGTTTACTGAAATTCTTATAAGTCAGCATCCAAGTT

TTGAAAATAAAAAAAAAATAGAGAATTCTTTTATTTGGGACATCATGTTGATTACTACAAATAAAGAAATATTCTATTGTGTTTTGTTTGC
Translation
    - UNI34488 - MAGPPFLLWTPGEGYLAQHAQKNFSSPFAPGLQFERIREFPAVASSYYLAVAGRRVWFHGSKSSINQDFWERVKKGCSTAAAM

GGAHTQPCTWPHTHTLFVLGPVPLPPRCCSPFSIPLRYTVSSALNLTLELAVREEADKLILSQCIWLIGCNGGCPPRGISISTGIKALNQRNRALKTLEF

QASASGKGVFKLRGNEAFFGAPEITSCRQLLIC
Transcript ENSMUST00000068507
Sequence
AGTCTCTCGGTGCCTATTTATGAAGGAAGTTCCCGATGACCCTGCAACTCACAATCATTTCCACCCCATATCCGCTTGCTTATTTTCTCTCATTCAGAAG

GATCTGAGGCCAGTTGACCTGGCCTGGAGGCTGTATCCATAACCATTGCACTGCATTGCAGAAGTGGGGAGCAAAGGCGATGAAGAAGGGGAGACTCAGC

TGTGCCTTTGCTGGTATTCTAGCTGAGAACTGATGGAGACTGGAACTGAAATACAACATCAGATGATGAATGAGACAACTGAGCCTGG AAGACAACACT

GAAGCCTGGAGACAGAGGTGGGAAGAATCTCATTGCAATTGTCCTCCAAGACATTG GAGTGGAAACTGATTCAGTCTACTGGACCAAGAAGGAAAAGAG

CCCCCTTGAGGAAGAGTGGCTGATCTAAATGTAAACAAG ATGTTTCTGGCTTACAAATCTCCCTGTTGCTAGTATTGCAGCAAATCACAAAGAGGTGGG

AAGCTGCAGCACACCAAAAGTGCACCATCACCTTGATCCCGCAGATCCTGTGAAAAGGCTTTTCAG - UNI34488 - AAGCAACTGTCTCGCCTCAT

TCGAGACAAGCTCCCTTCCTCGTGCTCCGTTTTTGTCAGTGATTCCTCTGAACTCTTCAGTAAGAGAAGCAGAGAGGTAATCAGTGTGGGGCTACAAAAG

GACATGCTGATTGAAAGAGTGTTCGTTCGCCTTGGACAATCATGGCTCTGTGCTCTCAGACCCAGTTGAAAGTGTTTAGATAGCATGGCTGGACCCCCTT

TTCTCCTTTGGACCCCAGGGGAAGGCTATCTAGCCCAGCATGCCCAGAAGAACTTTTCTTCACCTTTTGCTCCTGGACTCCAGTTTGAAAGAATTCGAGA

ATTCCCAGCTGTAGCCAGCAGCTATTATCTTGCTGTAGCAGGGAGGAGAGTCTGGTTCCATGGCTCCAAAAGCAGCATAAATCAAGATTTCTGGGAGAGG

GTTAAGAAAGGGTGTTCAACAGCTGCCGCCATGGGAGGAGCGCATACACAGCCATGCACATGGCCACACACACACACATTATTTGTCTTGGGCCCAGTTC

CTTTGCCCCCCAGGTGTTGTTCTCCTTTTTCCATCCCTCTCAGGTACACAGTGTCTTCTGCTCTTAACCTCACTCTCGAACTTGCTGTCAGGGAAGAAGC

TGACAAACTCATCCTATCTCAATGTATCTGGTTGATAGGATGTAATGGGGGCTGCCCACCCAGGGGTATAAGTATTTCAACAGGGATCAAAGCTTTAAAC

CAAAGGAACAGAGCTCTAAAAACTCTGGAATTCCAGGCATCCGCCAGTGGGAAGGGAGTGTTTAAACTGAGGGGCAATGAGGCCTTTTTTGGTGCACCTG

AAATCACATCATGTAGACAGTTGCTTATATGTTAGGCTGCTTGCTGCTCACAGTCAACACCTCTTGTGCCACACCTCTGAGCTAGATGGCACACAGCCAC

TTTGTCTCCTCTTCCCTTGCACTGTATGAGTCCTTTGTGGGCCAGAGGGAAGGGGAGGCGCCAGGCACACTGATCCCAATTCTCCCAGATGTATAAGCTA

TGATCAGAGGATGAATTATAGTCCTTTGGGAAAGAGTGTTCATTCATCCATCGCAGCCAGCAGGCCAGTGCAATGTAAATGGTAACTTTGTAAGTTGAAA

GACTTAAAGCCATTTTGAAAATTGCATAATAATCTCAGGCAGAATTTGGCTCCATGTATGTGGAAAATTAATAGATGTGACTGGGATGCTTGCATTGTGA

GTTGTGGAGGGCTAACCTCACTTCAGACTTGAGACTATGCTCTGCCCTCACTAAATCCACAAAGTTTACTGAAATTCTTATAAGTCAGCATCCAAGTTTT

GAAAATAAAAAAAAAATAGAGAATTCTTTTATTTGGGACATCATGTTGATTACTACAAATAAAGAAATATTCTATTGTGTTTTGTTTGC
Translation
    - UNI34488 - MAGPPFLLWTPGEGYLAQHAQKNFSSPFAPGLQFERIREFPAVASSYYLAVAGRRVWFHGSKSSINQDFWERVKKGCSTAAAM

GGAHTQPCTWPHTHTLFVLGPVPLPPRCCSPFSIPLRYTVSSALNLTLELAVREEADKLILSQCIWLIGCNGGCPPRGISISTGIKALNQRNRALKTLEF

QASASGKGVFKLRGNEAFFGAPEITSCRQLLIC

For any suggestions or comments, please send an email to unitrap@crg.es