Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000055150 (Zfp78)
Chromosomal location
Chr 7: 6316043 - 6335315 (+)
Description
zinc finger protein 78 Gene [Source:MGI Symbol;Acc:MGI:107783]
RefSeq_dna
NM_177888 NM_001025163 
RefSeq_peptide
NP_001020334.1 NP_808556.1 NP_001106276.1 
UniGene
Mm.136456 
MGI
MGI:107783 
Uniprot/SPTREMBL
Q3UY47 Q5U406 Q60919 Q69ZK4 Q8BJ21 
Human Ortholog
ENSG00000196263 (ZNF471)
Omim not available
UniTrap UNI25943
Vector Insertion
Chr 7: 6325961 - 6328228
Public Clones not available
Private Clones OST149784 (lexicon)
Severity of mutation (?) Insertion after 11% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000086323
Sequence
ATGACAGTTGAACTAATGAAAGCCATGCTACAG GAAGCAGTGACATTCAACGATGTTGCAATAGACTTTTCTCCGGAGGAGTGGGACTGGCTGAATCCT

GCTCAGAGGAGTTTGTACAGGACTGTGGTGCTGGAGAACTACCGGAACTTGGTCTCTGTGG - UNI25943 - GAGCTTGCATTTCCAAACCATCTCT

AATCTCCTTATTGGAACATGGGAAGGAGCCTTGGGAGGTGAAGGGTCAGGTGACAGGAAGCAGAGTACAAG GTGGTAAATCTGTACAGAAGACACACGA

ATTATCTCTCAGGCAGTTGGTGTTTGAGGATGTGGCAGTGGAGAACACTACAAGTCTTGGTTGTGAGTCTCTCACTTCTGGAAGGAAGCAGAAATGCAAA

GACCTTCTGGATAGACAGATGAGTCAAGAAATATTTAACCTGAAAGAAACAGTCACTCACAAAGGAACCCACACTAAAGAAATAGGCTACAAACACACCG

AATCCTTAAAATCTGCCCATCTGGATAGTGTAGAAGAGAATATTTATACTCACAAGTCAAATAAGAAAAGCTTCTCCAAAAATCCCAAGGTATGGAAATA

CAAGAAAATCTGGGCAGGGAAGACCATTTTTAAATGTAATGAATGTGAGAAAACCTTCACCCACAGCTCAGCTGTTACAGTTCACCAGAGAATTCACACG

GGGGAGAAACCATATCAATGCACCGTCTGCGGAAAGGCCTTCAAGCAGAGCCACCACCTGGCTCAGCACCACACAACACACACCCACGAGAAACTCTTCC

AGTGTGAGGAATGTAAGAAAGCCTTCAGCCAGAATTCATACCTCACTGTACACCGGAGAATTCACACCGGAGAAAAACCGTATAAATGTAAGGAGTGCGC

AAAGTCCTTCAGGCAGCCTGCCCACCTGGCTCAGCACCACAGGATTCACACGGGTGAGAAACCTTACAAGTGTGAAATCTGTGGGAAAGCCTTTAACCAC

AGCATGTCACTCACTGGCCACCAAAGAGTACATTCTGGAGAGAAACCATATAAATGCAAGGACTGTGGGAAAGCTTTTCGGCAGAGTATACACCTTGTTG

TTCACTCAAGAATTCATACTGGAGAAGAGCCCTATGAATGTAACGAATGTGGGAAGACCTTTAGGGAGAGTTCCCAGCTGACTATTCATCAGAGAAACCA

CACGGGAGAAAAACCTTTTGAATGTAAGCAGTGTGGTAAATTTTTCAATAGAAGTGCCTATCTTGCCAGACATCAGAAAATCCATACAGGAGAGAAACCT

TATGAGTGTAATGAATGCGGCAAAACCTTCACACATGCTGCCTATCTTATAAGACACAAGAGGGTCCATACTGGAGAGAAGCCTTACAAATGTGCGGAAT

GTGGAAAGGCATTTGGTGATGGCTCCTCCCGTGCTCAGCATCAGAGACTTCACACTGGTCAGAGGCCCTATGTATGTGAGAAATGTGGAAGGGCCTTCAG

AAGAAAGTCATCCCTTAATTGCCACCAAAGGTATCACACTGGAAAGAAACTGTAAAAATGTGTCCCCCATGGCAAACCCTTTAGCCGCCTACGAACCTGT

AGCGTTCATCAGAGAATTTAGCTTTCAACCAGATTGTTCACTGTACTCTACATGGAAGATCTCACACAGGTCAAAGAGCTCTTAGGAATGTAAGGGATGG

GGAGAAATCTTCAGTAAATGTTCCTAAACCACCCATCATTGGTGAGTTCTTGATGCAGTCATCTCAGGCATCCCTCCCTGTCCTCAGGTCCTGTGCATAT

ACCTGCTAAGTATTTCCATTTAGGTTTGGCCCCTTAGCCTCCTGATCCAAAACACAATTGTTTTGCTTGGACTTTTTCAAATGTCTGTAATCCATCTTGT

TTCCTTCAAGTTTATTACTCATTTATTTTACAGTCAGAAAATTTCTTTTTAAAAATATACATGTTATTTATGTAACTCTTCTAATACTCATTGTAAAATG

TTTATTTAATGCACATAAAATGTTTAGCCACATGATTGACTGTATTAAGTTTGGATGGAGAACATCCCTTCAATGATTAGGAGACACATCAGCACAGAAC

ACAGAGAGGCCACACACAGAGGCAAAGGAACATGAGGGGGTATCCCTGAGCCAATGCTTTATTGGGCCCAGGGTTACAGATTTCCTTTGTTGAGTCGCAA

CAAGCAGGCATGAGTTCTGGGAGGTCATCTCAGGTGTAGAAAGTGATCATTGCGACATATGTGCCCAGTCCATCTTCAGCAGTGCATTTAAAGGGAGCAG

TGAAGGCAGGCAGCCCCCTTTGACGGGTTCTTGTTCTTGGCACCAGCTTGAGCCACTTGTGGATGGTGTGATACTAGGAAGTGTCAAAGGTGACTGACCT

ACACCTCCAGCCTGGGAAAGTTAAAACTTCAATGAAATAGATACCAAGAGAACATAAAATGAAAGGACTTCAATACACTGACCCATAGGGGTGCTTAGAA

AATGTGTTAGACCAGAAAAATTATTTCTAAACCATGGCCTCTCAAATTTGGAACTTAGGTGATGACAACAATTTAGAAACTGAAAGTGTCTTCAGGTGGA

ACAATTAGTATGTGTAGTGTATTTAAGATGGAAGCTTTCTAATGATCCTAAAGGTTATGTTTTCTTATTGGTAAAGAAATTAAATCTGGTCTGGTACGTA

GAATCTGTTTTAGGAAGTGCCTAGAAGTTAAAGACTGGAACAAAGAATTAGAATTTATTTGGGAAAAAATACACATGTGTATATATAGTCTAGGTCACAA

AAGAAACATTCTTATATTTACTAACAAGCCCCCAGCAGGCCAGTCTAGCCGAAACAGGGAGCCCCAGGCTTACCATGAGATCCTATCTCAAAATGTAAGG

TGGAGGGCGACAGACTCCCAACACCGACTAATGGTCTCCACACACACGCACATGGGCAATCAAGCCTACAAATGCATATATACAAATAAATAAATAAAAG

TAAAATTTGAAAGGGTGATTGTGGCTGTGTTTGGAGGCACACACATCTCATTTCAGCACTCTGGAGGTAGAGACAGATGGGTCTCTGAGTTAGAGATCAG

CCAGGTTTACAGAGTTCTAGGGCAGTCAGGGCTACATAGCGAGGCCTTGGATAAAAACAAACTGAAAGATCACATGCAAGATGAGTACACACTGCAGAAA

TAGGAAAACAGGGGACACAAACTTCCATTCTCGTTGTTCCAGAGGACTCTGGGTGGTTTTTGTAAAGTCCATCTCATGGTAGGTTCTGTTGGACTGTATG

CCTGCCTTTCCTTGTTTATCCTAAGTTCATTCTCTTCCTCTACCCCCCACCCAATTTGTTATCAAATTGCCAGGGCTGGCGAGATGGCTCAGTGGTTAAG

AGCGCTTGCTGGTTTTGCAGAGGACTTGGATTTGGGTCCCAGCACCCATATAGCAGCTCACAACTGTCTGTAACCCAACTTCCAGGGGATGCTCTTTTCT

GGGCTCCACAAGAACTGTAGGCACGCAATGCACACAATACATGAAGACAAAACACTCATCCACATAAAATAAAAGCAAGTCTTTCAGGGGCTGGAGAGAT

GGCTCAGATGTTAAGAGCAGTCTGCTCTTCCCAAAATCCTGAGTTCAATTCCCAGCAACCATATGGTGGCTCACAACCATTTATCCTGGGATCTGATGCC

CTCTTCTGGAAAGCGGATGTACATACAGATAGAGCATCATTTACATAAAATAATAAACCAACCTTTCAAAAAATCTTTGTGGTGACAATGCTGCAATATT

GTTTTTGCTTAAGAATTTTTTAGTATAAAATTTCCTTCTGGTTATATGAGGTGTTTGTGAAGCATAAATGGTTTTATATTTAGATGTTGGTTTCTTTTCT

AAAATATTTCATTACGGTATGCACATATTTACCACTCAGAAAAAAAAATAACACTTTTGTTCTCAAACATTTTATATAAAGAATATTCTGCTTGCTCAGC

GGTAGTGACACACACTTTTAAAACCAGCCCTTCCAGAGGCAGAGGCAGGCAGATCTCCGAGTTCGAGGCCAGCCTGGTCTACAGAGTGAGTTCCAGAACA

TCCAGAGCCACACAACACTCTCTCAGATGATAACTGAATGACAAAAATAGGCAGCTCACAGTCCTAAATGGGACATTCTTGTATACCTTCTCAAGGGTCT

GGGAACATCGTATTAGACGAAGGAGAAAGAATGTAAGAGTCTGAGAATGGCAAGGAGTGCTGTGGAATGGTTTTGGGCATGTTGTGCTCATGAACTCATA

GAAACTGATTACCAGCACAAGATTGCTGGTAATTACCAGCGCCGATCAATATTATAGCCATTGATAGAGGAAGGGCGTACCCCTCCACACCTAGCTGAGG

AGCTATAAGCAAATGATGGCAGCTGAGAGAGTGGGAGTCATTTTTCTTTGGGGATGTGGCCTCTGGTAGATTGTTCATGTCACACTCCACTGGTATACTG

GTAGGCGGCACTAACAGGGCTATATTTAAAAAAAAAGTGTGGTGGGGTGGCAAAAGGAATGTGGAAGTATTGGGGATGGTTGGGAGAGGAGATGTGTTGG

ATATGATCAAGATACAGTATATATACATGTATGAAACCGACAAAGAATAAACTGCGCTCCCCTCACCTC
Translation
MTVELMKAMLQ EAVTFNDVAIDFSPEEWDWLNPAQRSLYRTVVLENYRNLVSVG - UNI25943 - GACISKPSLISLLEHGKEPWEVKGQVTGSRV

QG GGKSVQKTHELSLRQLVFEDVAVENTTSLGCESLTSGRKQKCKDLLDRQMSQEIFNLKETVTHKGTHTKEIGYKHTESLKSAHLDSVEENIYTHKSN

KKSFSKNPKVWKYKKIWAGKTIFKCNECEKTFTHSSAVTVHQRIHTGEKPYQCTVCGKAFKQSHHLAQHHTTHTHEKLFQCEECKKAFSQNSYLTVHRRI

HTGEKPYKCKECAKSFRQPAHLAQHHRIHTGEKPYKCEICGKAFNHSMSLTGHQRVHSGEKPYKCKDCGKAFRQSIHLVVHSRIHTGEEPYECNECGKTF

RESSQLTIHQRNHTGEKPFECKQCGKFFNRSAYLARHQKIHTGEKPYECNECGKTFTHAAYLIRHKRVHTGEKPYKCAECGKAFGDGSSRAQHQRLHTGQ

RPYVCEKCGRAFRRKSSLNCHQRYHTGKKL
Transcript ENSMUST00000036994
Sequence
GACAGCGTCTGGGTAAGGCAGCTAGCGGGCGCTTGTTAGGGAGTGGGAGCCCGAGCGCTGCGGGCAGGGGAGATCCTCGTGGTCCCTGTGTTTTCTGTCT

GGAG TTCCCTAATCCCTGAGAGGATGGGTTGGAGGAAGACATCCCATTTAGGACTGCGTGTTCCAAGATCTCTCGCTCTGTGTACACTGTCCAGGAGCT

TGTCTTTGTGTCAGTTCTCATCTCCTGCCAGAGGACGCTTCTTTGATAATGG GTTGGACTTCCCAGGATACAGTTGTTCTCCAAGAGAGAAGCCAGGAG

GAGGATAAGACATGACAGTTGAACTAATGAAAGCCATGCTACAG GAAGCAGTGACATTCAACGATGTTGCAATAGACTTTTCTCCGGAGGAGTGGGACT

GGCTGAATCCTGCTCAGAGGAGTTTGTACAGGACTGTGGTGCTGGAGAACTACCGGAACTTGGTCTCTGTGG - UNI25943 - GTGGTAAATCTGTA

CAGAAGACACACGAATTATCTCTCAGGCAGTTGGTGTTTGAGGATGTGGCAGTGGAGAACACTACAAGTCTTGGTTGTGAGTCTCTCACTTCTGGAAGGA

AGCAGAAATGCAAAGACCTTCTGGATAGACAGATGAGTCAAGAAATATTTAACCTGAAAGAAACAGTCACTCACAAAGGAACCCACACTAAAGAAATAGG

CTACAAACACACCGAATCCTTAAAATCTGCCCATCTGGATAGTGTAGAAGAGAATATTTATACTCACAAGTCAAATAAGAAAAGCTTCTCCAAAAATCCC

AAGGTATGGAAATACAAGAAAATCTGGGCAGGGAAGACCATTTTTAAATGTAATGAATGTGAGAAAACCTTCACCCACAGCTCAGCTGTTACAGTTCACC

AGAGAATTCACACGGGGGAGAAACCATATCAATGCACCGTCTGCGGAAAGGCCTTCAAGCAGAGCCACCACCTGGCTCAGCACCACACAACACACACCCA

CGAGAAACTCTTCCAGTGTGAGGAATGTAAGAAAGCCTTCAGCCAGAATTCATACCTCACTGTACACCGGAGAATTCACACCGGAGAAAAACCGTATAAA

TGTAAGGAGTGCGCAAAGTCCTTCAGGCAGCCTGCCCACCTGGCTCAGCACCACAGGATTCACACGGGTGAGAAACCTTACAAGTGTGAAATCTGTGGGA

AAGCCTTTAACCACAGCATGTCACTCACTGGCCACCAAAGAGTACATTCTGGAGAGAAACCATATAAATGCAAGGACTGTGGGAAAGCTTTTCGGCAGAG

TATACACCTTGTTGTTCACTCAAGAATTCATACTGGAGAAGAGCCCTATGAATGTAACGAATGTGGGAAGACCTTTAGGGAGAGTTCCCAGCTGACTATT

CATCAGAGAAACCACACGGGAGAAAAACCTTTTGAATGTAAGCAGTGTGGTAAATTTTTCAATAGAAGTGCCTATCTTGCCAGACATCAGAAAATCCATA

CAGGAGAGAAACCTTATGAGTGTAATGAATGCGGCAAAACCTTCACACATGCTGCCTATCTTATAAGACACAAGAGGGTCCATACTGGAGAGAAGCCTTA

CAAATGTGCGGAATGTGGAAAGGCATTTGGTGATGGCTCCTCCCGTGCTCAGCATCAGAGACTTCACACTGGTCAGAGGCCCTATGTATGTGAGAAATGT

GGAAGGGCCTTCAGAAGAAAGTCATCCCTTAATTGCCACCAAAGGTATCACACTGGAAAGAAACTGTAAAAATGTGTCCCCCATGGCAAACCCTTTAGCC

GCCTACGAACCTGTAGCGTTCATCAGAGAATTTAGCTTTCAACCAGATTGTTCACTGTACTCTACATGGAAGATCTCACACAGGTCAAAGAGCTCTTAGG

AATGTAAGGGATGGGGAGAAATCTTCAGTAAATGTTCCTAAACCACCCATCATTGGTGAGTTCTTGATGCAGTCATCTCAGGCATCCCTCCCTGTCCTCA

GGTCCTGTGCATATACCTGCTAAGTATTTCCATTTAGGTTTGGCCCCTTAGCCTCCTGATCCAAAACACAATTGTTTTGCTTGGACTTTTTCAAATGTCT

GTAATCCATCTTGTTTCCTTCAAGTTTATTACTCATTTATTTTACAGTCAGAAAATTTCTTTTTAAAAATATACATGTTATTTATG
Translation
  MTVELMKAMLQ EAVTFNDVAIDFSPEEWDWLNPAQRSLYRTVVLENYRNLVSVG - UNI25943 - GGKSVQKTHELSLRQLVFEDVAVENTTSL

GCESLTSGRKQKCKDLLDRQMSQEIFNLKETVTHKGTHTKEIGYKHTESLKSAHLDSVEENIYTHKSNKKSFSKNPKVWKYKKIWAGKTIFKCNECEKTF

THSSAVTVHQRIHTGEKPYQCTVCGKAFKQSHHLAQHHTTHTHEKLFQCEECKKAFSQNSYLTVHRRIHTGEKPYKCKECAKSFRQPAHLAQHHRIHTGE

KPYKCEICGKAFNHSMSLTGHQRVHSGEKPYKCKDCGKAFRQSIHLVVHSRIHTGEEPYECNECGKTFRESSQLTIHQRNHTGEKPFECKQCGKFFNRSA

YLARHQKIHTGEKPYECNECGKTFTHAAYLIRHKRVHTGEKPYKCAECGKAFGDGSSRAQHQRLHTGQRPYVCEKCGRAFRRKSSLNCHQRYHTGKKL
Transcript ENSMUST00000108559
Sequence
GACAGCGTCTGGGTAAGGCAGCTAGCGGGCGCTTGTTAGGGAGTGGGAGCCCGAGCGCTGCGGGCAGGGGAGATCCTCGTGGTCCCTGTGTTTTCTGTCT

GGAG TTCCCTAATCCCTGAGAGGATGGGTTGGAGGAAGACATCCCATTTAGGACTGCGTGTTCCAAGATCTCTCGCTCTGTGTACACTGTCCAGGAGCT

TGTCTTTGTGTCAGTTCTCATCTCCTGCCAGAGGACGCTTCTTTGATAATGG GTTGGACTTCCCAGGATACAGTTGTTCTCCAAGAGAGAAGCCAGGAG

GAGGATAAGACATGACAGTTGAACTAATGAAAGCCATGCTACAG GAAGCAGTGACATTCAACGATGTTGCAATAGACTTTTCTCCGGAGGAGTGGGACT

GGCTGAATCCTGCTCAGAGGAGTTTGTACAGGACTGTGGTGCTGGAGAACTACCGGAACTTGGTCTCTGTGG - UNI25943 - GAGCTTGCATTTCC

AAACCATCTCTAATCTCCTTATTGGAACATGGGAAGGAGCCTTGGGAGGTGAAGGGTCAGGTGACAGGAAGCAGAGTACAAG GTGGTAAATCTGTACAG

AAGACACACGAATTATCTCTCAGGCAGTTGGTGTTTGAGGATGTGGCAGTGGAGAACACTACAAGTCTTGGTTGTGAGTCTCTCACTTCTGGAAGGAAGC

AGAAATGCAAAGACCTTCTGGATAGACAGATGAGTCAAGAAATATTTAACCTGAAAGAAACAGTCACTCACAAAGGAACCCACACTAAAGAAATAGGCTA

CAAACACACCGAATCCTTAAAATCTGCCCATCTGGATAGTGTAGAAGAGAATATTTATACTCACAAGTCAAATAAGAAAAGCTTCTCCAAAAATCCCAAG

GTATGGAAATACAAGAAAATCTGGGCAGGGAAGACCATTTTTAAATGTAATGAATGTGAGAAAACCTTCACCCACAGCTCAGCTGTTACAGTTCACCAGA

GAATTCACACGGGGGAGAAACCATATCAATGCACCGTCTGCGGAAAGGCCTTCAAGCAGAGCCACCACCTGGCTCAGCACCACACAACACACACCCACGA

GAAACTCTTCCAGTGTGAGGAATGTAAGAAAGCCTTCAGCCAGAATTCATACCTCACTGTACACCGGAGAATTCACACCGGAGAAAAACCGTATAAATGT

AAGGAGTGCGCAAAGTCCTTCAGGCAGCCTGCCCACCTGGCTCAGCACCACAGGATTCACACGGGTGAGAAACCTTACAAGTGTGAAATCTGTGGGAAAG

CCTTTAACCACAGCATGTCACTCACTGGCCACCAAAGAGTACATTCTGGAGAGAAACCATATAAATGCAAGGACTGTGGGAAAGCTTTTCGGCAGAGTAT

ACACCTTGTTGTTCACTCAAGAATTCATACTGGAGAAGAGCCCTATGAATGTAACGAATGTGGGAAGACCTTTAGGGAGAGTTCCCAGCTGACTATTCAT

CAGAGAAACCACACGGGAGAAAAACCTTTTGAATGTAAGCAGTGTGGTAAATTTTTCAATAGAAGTGCCTATCTTGCCAGACATCAGAAAATCCATACAG

GAGAGAAACCTTATGAGTGTAATGAATGCGGCAAAACCTTCACACATGCTGCCTATCTTATAAGACACAAGAGGGTCCATACTGGAGAGAAGCCTTACAA

ATGTGCGGAATGTGGAAAGGCATTTGGTGATGGCTCCTCCCGTGCTCAGCATCAGAGACTTCACACTGGTCAGAGGCCCTATGTATGTGAGAAATGTGGA

AGGGCCTTCAGAAGAAAGTCATCCCTTAATTGCCACCAAAGGTATCACACTGGAAAGAAACTGTAAAAATGTGTCCCCCATGGCAAACCCTTTAGCCGCC

TACGAACCTGTAGCGTTCATCAGAGAATTTAGCTTTCAACCAGATTGTTCACTGTACTCTACATGGAAGATCTCACACAGGTCAAAGAGCTCTTAGGAAT

GTAAGGGATGGGGAGAAATCTTCAGTAAATGTTCCTAAACCACCCATCATTGGTGAGTTCTTGATGCAGTCATCTCAGGCATCCCTCCCTGTCCTCAGGT

CCTGTGCATATACCTGCTAAGTATTTCCATTTAGGTTTGGCCCCTTAGCCTCCTGATCCAAAACACAATTGTTTTGCTTGGACTTTTTCAAATGTCTGTA

ATCCATCTTGTTTCCTTCAAGTTTATTACTCATTTATTTTACAGTCAGAAAATTTCTTTTTAAAAATATACATGTTATTTATG
Translation
  MTVELMKAMLQ EAVTFNDVAIDFSPEEWDWLNPAQRSLYRTVVLENYRNLVSVG - UNI25943 - GACISKPSLISLLEHGKEPWEVKGQVTGS

RVQG GGKSVQKTHELSLRQLVFEDVAVENTTSLGCESLTSGRKQKCKDLLDRQMSQEIFNLKETVTHKGTHTKEIGYKHTESLKSAHLDSVEENIYTHK

SNKKSFSKNPKVWKYKKIWAGKTIFKCNECEKTFTHSSAVTVHQRIHTGEKPYQCTVCGKAFKQSHHLAQHHTTHTHEKLFQCEECKKAFSQNSYLTVHR

RIHTGEKPYKCKECAKSFRQPAHLAQHHRIHTGEKPYKCEICGKAFNHSMSLTGHQRVHSGEKPYKCKDCGKAFRQSIHLVVHSRIHTGEEPYECNECGK

TFRESSQLTIHQRNHTGEKPFECKQCGKFFNRSAYLARHQKIHTGEKPYECNECGKTFTHAAYLIRHKRVHTGEKPYKCAECGKAFGDGSSRAQHQRLHT

GQRPYVCEKCGRAFRRKSSLNCHQRYHTGKKL

For any suggestions or comments, please send an email to unitrap@crg.es