Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000055200 (Sertad3)
Chromosomal location
Chr 7: 28258787 - 28262378 (+)
Description
SERTA domain containing 3 Gene [Source:MGI Symbol;Acc:MGI:2180697]
RefSeq_dna
NM_133210 
RefSeq_peptide
NP_573473.1 
UniGene
Mm.200120 
MGI
MGI:2180697 
Uniprot/SWISSPROT
Q9ERC3 
Uniprot/SPTREMBL
Q3UYB0 
Human Ortholog
ENSG00000167565 (SERTAD3)
Omim not available
UniTrap UNI16360
Vector Insertion
Chr 7: 28258891 - 28261158
Public Clones IST14963F1 (tigm)
Private Clones OST462383 (lexicon) OST425541 (lexicon) OST412886 (lexicon) OST319668 (lexicon)
OST250946 (lexicon) OST250913 (lexicon) OST250858 (lexicon) OST215253 (lexicon)
OST124218 (lexicon) OST105179 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000068641
Sequence
AGACCCAGAGGCCCGGGGAAAGTGAGCCGGACTTCTACCCAGCACTGGTGGAACCCAACCCTGCAGGCTTGTCGGAGGTAGTCGTGGCGACCCTGGCAGC

CGAG - UNI16360 - GACATGGGAGGCTTAAAGAGGAAACATTCTGATTTGGAAGAGGAGGAGGAAGAGGAGAAGTGGGACTGGAGTCCAACAGCTC

TTCGGAGCTACCAGCAAGCCCTGCTCCGAATCTCTCTGGACAAAGTCCAGCGCAGCCTGGGCCCCAGAGCACCCAGCCTCCGCAGGCACGTCCTTATCCA

CAACACACTCCAGCAGCTCCAGGCTGCCATTCGCCTCGCTCCAGCACCAGCCCTGCCCCCGGAACCTCTCTTCCTAGGTGAAGAAGATTTCTCCCTATCT

ACCACCATCGGTTCCATCCTCAGGGAGCTAGATACATCCATGGATGAGATGGAGCCGCCTCTGAATCCAGCAGCTTCCTCGAGTCCCCAGAATGAGATCG

TGTCCCAGGCTGATCCTGTATTCTTAGAAGCTCTGAGCTCAAGGTACCTGGGAGACTCTGGCCTGGATGACTTCTTTCTGGACATTGATACATCTGCGGT

GGAAAAGGACGTTGCACTTCCACCCCCGGAGCCGCCGCACAGCCTCTTCTGTAGCCCAGGATCCTGGGAGTGGAATGAACTGGACCACATCATGGAAATC

ATCCTGGGATCCTAAAGCTGATGGGATTCTTCCGGGCGTCAGCCTCAGTGCGCTGGGCCTTAGATGGGACTCTTGTATGTGTGCGTGGCGGAGGCGCTAG

ACAGAGACTGTGTGGCCTCCTTTCCTCCTATGTCAGGATTCCACAAACTGTCCTGCATGTGTGCGTGTCTGGTTGCCACAGCCTTCCGTGAAGGTGCGTC

TTCCTCAATTAATTTATCTCTTCCGAATGCCTTAAGGAGACTCTATTTCAGGGAGTCTAGATTCCTCGCTTACACATTTCTTCTGCCTCCAGTTCCCACT

GTCCTTATGACCACTAGGGTCTCAGGGAAGATAAAACTGGACCTGTCAAGGGGTGATGGAGGGGCTGGTCTCCGGACAGACTCAACCTCTTGGCAGGACC

CCAGTACCAGCAGCCTCCTGATTCATAACCAGGCCGGACCATGTGCAATAGGGCAGAAGTCTACCAGCTCCATGCTGTGCTACTTAAGAGGAAAGAGGAG

GTAGGGTTTGCAGAGGCGTATGTTTGTTGGTTGGTTGGTTGGTTGGTTGGTTTGGGGGGATTTTTTGAGTGAAATTTGTTGTTGTTGTTGTTGTTCTTGT

TTTTTTGTTTTTGTTTTTTTCTAATAAAAGCATTTTGG
Translation
 - UNI16360 - MGGLKRKHSDLEEEEEEEKWDWSPTALRSYQQALLRISLDKVQRSLGPRAPSLRRHVLIHNTLQQLQAAIRLAPAPALPPEPLFLG

EEDFSLSTTIGSILRELDTSMDEMEPPLNPAASSSPQNEIVSQADPVFLEALSSRYLGDSGLDDFFLDIDTSAVEKDVALPPPEPPHSLFCSPGSWEWNE

LDHIMEIILGS

For any suggestions or comments, please send an email to unitrap@crg.es