Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000055254 (Ntrk2)
Chromosomal location
Chr 13: 58909261 - 59235331 (+)
Description
neurotrophic tyrosine kinase, receptor, type 2 Gene [Source:MGI Symbol;Acc:MGI:97384]
RefSeq_dna
NM_008745 NM_001025074 
RefSeq_peptide
NP_032771.1 NP_001020245.1 
UniGene
Mm.401305 Mm.401508 Mm.402650 Mm.130054 
MGI
MGI:97384 
Uniprot/SWISSPROT
P15209 
Uniprot/SPTREMBL
B5BQV3 B5BQV4 Q3UHE3 
Human Ortholog
ENSG00000148053 (NTRK2)
Omim 600456 - NEUROTROPHIC TYROSINE KINASE, RECEPTOR, TYPE 2  
UniTrap UNI13941
Vector Insertion
Chr 13: 58979624 - 59033383
Public Clones CMHD-GT_163E7-3 (cmhd) CMHD-GT_442B4-3 (cmhd) CMHD-GT_442B1-3 (cmhd)
Private Clones OST103043 (lexicon)
Severity of mutation (?) Insertion after 53% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI33589
Vector Insertion
Chr 13: 59033422 - 59087162
Public Clones IST11793D6 (tigm) IST10088G7 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 53% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI37991
Vector Insertion
Chr 13: 59087352 - 59139327
Public Clones (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 61% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI33671
Vector Insertion
Chr 13: 59161824 - 59227793
Public Clones IST14800G4 (tigm) IST15096F10 (tigm) IST13565A10 (tigm) IST14503A7 (tigm)
IST12747G11 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 85% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000109838
Sequence
GCTGCTTCTGCAGCGCTCTGCTCCCTGCGCTTGCTACGGGAGGCCGGGGAAGCCGCGCGGACAGTCCTCGGTGGCCTGGGCCGGCACTGTCCTGCTACCG

CAGTTGCTCCCCAG CCCTGAGGTGCGCACCGATATCGATATTCGTGCCGGTTTAGCGGTTCTGCGACCCAAAGAGTCCAGGGAGATCCACCGAGTGGTG

CCTGGCGTATAGGACTATGCAGCCGCCTTGTGGCTCGGAGCAGCGGCCCGCGATGTCCCAGCCACTGTGAACCATTTGGTCAGCGCCAACCTGCTCAGCC

CCAGCACCGACAGGCTCAGCCTCTGGTACGCTCCACTCCGCGGGAGGCCACCAGCACCAAGCAGCAAGAGGGCGCAGGGAAGGCCTCCCCCCTCCGGCGG

GGGACGCCTGGCTCAGCGTAGGGACACGCACTCCGACTGACTGGCACTGGCAGCTCGGGATGTCGCCCTGGCTGAAGTGGCATGGACCCGCCATGGCGCG

GCTCTGGGGCTTATGCCTGCTGGTCTTGGGCTTCTGGAGGGCCTCTCTCGCCTGCCCGACGTCCTGCAAATGCAGTTCCGCTAGGATTTGGTGTACTGAG

CCTTCTCCAGGCATCGTGGCATTCCCGAGGTTGGAACCTAACAGCGTTGACCCGGAGAACATCACGGAAAT TCTCATTGCAAACCAGAAAAGGCTAGAA

ATCATCAATGAAGATGACGTTGAAGCTTACGTGGGGCTGAGAAACCT TACAATTGTGGATTCCGGCTTAAAGTTTGTGGCTTACAAAGCGTTTCTGAAA

AACAGCAACCTGCGGCACAT AAATTTCACACGAAACAAGCTGACGAGTTTGTCCAGGAGACATTTCCGCCACCTTGACTTGTCTGACCT GATCCTGAC

GGGTAATCCGTTCACGTGCTCCTGCGACATCATGTGGCTCAAGACTCTCCAGGAGACTAAATCCAGCCCCGACACTCAGGATTTGTACTGCCTCAATGAG

AGCAGCAAGAACATGCCCCTGGCGAACCTGCAGATACCCAATTGTG GTCTGCCATCTGCACGTCTGGCTGCTCCTAACCTCACCGTGGAGGAAGGAAAG

TCTGTGACCCTTTCCTGCAGTGTGGGGGGTGACCCACTCCCCACCTTGTACTGGGACGTTGGGAATTTGGTTTCCAAGCACATG AATGAAACAAGCCAC

ACACAGGGCTCCTTAAGGATAACGAACATTTCATCTGATGACAGTGGAAAGCAAATCTCTTGTGTGGCAGAAAACCTTGTAGGAGAAGATCAAGATTCTG

TGAACCTCACTGTGCATT TTGCGCCAACTATCACGTTTCTCGAGTCTCCAACCTCAGATCACCACTGGTGCATTCCATTCACTGTGAGAGGCAACCCCA

AGCCTGCGCTTCAGTGGTTCTACAATGGGGCCATACTGAATGAGTCCAAGTACATCTGTACTAAGATCCACGTCACCAATCACACGGAGTACCATGGCTG

CCTCCAGCTGGATAACCCCACTCATATGAATAACGGAGACTACACCCTGATGGCCAAGAACGAGTATGGGAAGGATGAGAGACAGATCTCCGCTCACTTC

ATGGGCCGGCCTGGAGTCGACTACG AGACAAACCCAAATTACCCTGAAGTCCTCTATGAAG ACTGGACCACGCCAACTGACATTGGGGATACTACGAA

CAAAAGTAATGAAATCCCCTCCACGGATGTTGCTGACCAAAGCAATCGGGAGCATCTCTCG GTCTATGCCGTGGTGGTGATTGCATCTGTGGTGGGATT

CTGCCTGCTGGTGATGTTGCTCCTGCTCAAGTTGGCGAGACATTCCAAGTTTGGCATGAAAG - UNI13941 - GTTTTGTTTTGTTTCATAAGATCC

CACTGGATGGGTAG
Translation
 MSPWLKWHGPAMARLWGLCLLVLGFWRASLACPTSCKCSSARIWCTEPSPGIVAFPRLEPNSVDPENITEI ILIANQKRLEIINEDDVEAYVGLRNL 

LTIVDSGLKFVAYKAFLKNSNLRHI INFTRNKLTSLSRRHFRHLDLSDL LILTGNPFTCSCDIMWLKTLQETKSSPDTQDLYCLNESSKNMPLANLQI

PNCG GLPSARLAAPNLTVEEGKSVTLSCSVGGDPLPTLYWDVGNLVSKHM NETSHTQGSLRITNISSDDSGKQISCVAENLVGEDQDSVNLTVHF FA

PTITFLESPTSDHHWCIPFTVRGNPKPALQWFYNGAILNESKYICTKIHVTNHTEYHGCLQLDNPTHMNNGDYTLMAKNEYGKDERQISAHFMGRPGVDY

E ETNPNYPEVLYED DWTTPTDIGDTTNKSNEIPSTDVADQSNREHLS VYAVVVIASVVGFCLLVMLLLLKLARHSKFGMKG - UNI13941 - GF

VLFHKIPLDG
Transcript ENSMUST00000109839
Sequence
GCTGCTTCTGCAGCGCTCTGCTCCCTGCGCTTGCTACGGGAGGCCGGGGAAGCCGCGCGGACAGTCCTCGGTGGCCTGGGCCGGCACTGTCCTGCTACCG

CAGTTGCTCCCCAG CCCTGAGGTGCGCACCGATATCGATATTCGTGCCGGTTTAGCGGTTCTGCGACCCAAAGAGTCCAGGGAGATCCACCGAGTGGTG

CCTGGCGTATAGGACTATGCAGCCGCCTTGTGGCTCGGAGCAGCGGCCCGCGATGTCCCAGCCACTGTGAACCATTTGGTCAGCGCCAACCTGCTCAGCC

CCAGCACCGACAGGCTCAGCCTCTGGTACGCTCCACTCCGCGGGAGGCCACCAGCACCAAGCAGCAAGAGGGCGCAGGGAAGGCCTCCCCCCTCCGGCGG

GGGACGCCTGGCTCAGCGTAGGGACACGCACTCCGACTGACTGGCACTGGCAGCTCGGGATGTCGCCCTGGCTGAAGTGGCATGGACCCGCCATGGCGCG

GCTCTGGGGCTTATGCCTGCTGGTCTTGGGCTTCTGGAGGGCCTCTCTCGCCTGCCCGACGTCCTGCAAATGCAGTTCCGCTAGGATTTGGTGTACTGAG

CCTTCTCCAGGCATCGTGGCATTCCCGAGGTTGGAACCTAACAGCGTTGACCCGGAGAACATCACGGAAAT GATCCTGACGGGTAATCCGTTCACGTGC

TCCTGCGACATCATGTGGCTCAAGACTCTCCAGGAGACTAAATCCAGCCCCGACACTCAGGATTTGTACTGCCTCAATGAGAGCAGCAAGAACATGCCCC

TGGCGAACCTGCAGATACCCAATTGTG GTCTGCCATCTGCACGTCTGGCTGCTCCTAACCTCACCGTGGAGGAAGGAAAGTCTGTGACCCTTTCCTGCA

GTGTGGGGGGTGACCCACTCCCCACCTTGTACTGGGACGTTGGGAATTTGGTTTCCAAGCACATG AATGAAACAAGCCACACACAGGGCTCCTTAAGGA

TAACGAACATTTCATCTGATGACAGTGGAAAGCAAATCTCTTGTGTGGCAGAAAACCTTGTAGGAGAAGATCAAGATTCTGTGAACCTCACTGTGCATT 

TTGCGCCAACTATCACGTTTCTCGAGTCTCCAACCTCAGATCACCACTGGTGCATTCCATTCACTGTGAGAGGCAACCCCAAGCCTGCGCTTCAGTGGTT

CTACAATGGGGCCATACTGAATGAGTCCAAGTACATCTGTACTAAGATCCACGTCACCAATCACACGGAGTACCATGGCTGCCTCCAGCTGGATAACCCC

ACTCATATGAATAACGGAGACTACACCCTGATGGCCAAGAACGAGTATGGGAAGGATGAGAGACAGATCTCCGCTCACTTCATGGGCCGGCCTGGAGTCG

ACTACG AGACAAACCCAAATTACCCTGAAGTCCTCTATGAA GACTGGACCACGCCAACTGACATTGGGGATACTACGAACAAAAGTAATGAAATCCCC

TCCACGGATGTTGCTGACCAAAGCAATCGGGAGCATCTCTCG GTCTATGCCGTGGTGGTGATTGCATCTGTGGTGGGATTCTGCCTGCTGGTGATGTTG

CTCCTGCTCAAGTTGGCGAGACATTCCAAGTTTGGCATGAAAG - UNI13941 - - UNI33589 - GCCCAGCTTCGGTCATCAGCAACGACGATG

ACTCTGCCAGCCCCCTCCACCACATCTCCAATGGGAGTAACACTCCATCTTCTTCGGAGGGCGGTCCCGACGCTGTCATTATTGGAATGACCAAGATTCC

TGTTATTGAAAACCCCCAGTACTTTGGCATCACCAACAGTCAGCTCAAGCCAGACACAT TTGTTCAGCATATCAAGAGACACAACATCGTTCTGAAGAG

GGAACTTGGGGAAGGAGCCTTCGGGAAAGTTTTCCTTGCCGAGTGCTACAACCTCTGCCCAGAGCAGGATAAGATCCTGGTGGCTGTGAAG ACGCTGAA

GGACGCCAGCGACAATGCACGCAAGGACTTTCATCGGGAAGCTGAGCTGCTGACCAACCTCCAGCACGAGCACATTGTCAAGTTCTACGGTGTCTGTGTG

GAGGGCGACCCACTCATCATGGTCTTTGAGTACATGAAGCACGGGGACCTCAACAAGTTCCTTAG GGCACACGGGCCCGACGCAGTGCTGATGGCAGAG

GGTAACCCGCCCACAGAGCTGACGCAGTCGCAGATGCTGCACATCGCTCAGCAAATCGCAGCAGGTATGGTCTACCTGGCGTCCCAACACTTTGTGCACC

GTGACCTGGCCACCCGGAACTGCCTGGTGGGAGAGAACCTGCTGGTGAAAATTGGGGACTTTGGGATGTCCCGAGATGTGTACAGCACCGACTACTATCG

G - UNI33671 - GTCGGTGGCCACACAATGTTGCCCATCCGATGGATGCCTCCAGAGAGCATCATGTACAGGAAATTCACCACCGAGAGCGACGTCT

GGAGCCTGGGCGTTGTGTTGTGGGAGATCTTCACCTACGGCAAGCAGCCCTGGTATCAGCTATCGAACAATGAG GTGATAGAGTGCATCACCCAGGGAA

GAGTCCTTCAGCGGCCTCGAACGTGTCCCCAGGAGGTGTATGAGCTCATGCTTGGATGCTGGCAGCGGGAACCACACACCCGGAAGAACATCAAGAGCAT

CCACACCCTCCTTCAGAACTTGGCCAAGGCATCTCCCGTCTACCTGGATATCCTAGGCTAGGGTCCTCCTTCTGCCCAGACCGTCCTTCCCAAGGCCCTC

CTCAGACTGGCCTACACGACGAACCTCTTGACTGCCGCTGACGTCATGACCTTGCTGTCCTTCGCTCTGACAGTGTTGACAGGACCAGGAGCGGCTCTTT

GGGGGAGGCAGTGTGTGCTTCTCCATCCACAGACAGTATTAACTCGCTTCTGGCATTGTCTCTTTCTCTCCCTTGGGTTTGTTTCTTTCTTTTGCCCCTT

CCCCTTTTATCATTATTTATTCATTTATTTATTTTCTGGTCTTCACCGCTTCACGGCCCTCAGTCTCTCCTTGACCAATCTGGCTTCTGCATTCCTATTA

ACTGTACATAGACAAAGGCCTTAACAAACCTAATTTGTTATATCAGCAGACACTCCAGTTTGCCCACCACAACTAACAATGCCTTGTTGTATTCCTGCCT

TTGACGTGGATGAAAAAAAGGGAAAAAAAAATCAAACATCTGACTTAAGCTGTCACTTCCGATGTACAGACGTGGGGCGTTTCTATGGATTCACTTCTAT

TTATTATTTATTAATTTATTTATTTATCACTCTTCTTATTGTTTTCTGGTGGTTTTAACCTATGTGTGAGAAGGAAAAGTTGTGTACAATCTGGGAAAAC

TTTATCAGTGGGAAATGAAAACGAGAGCGAGCAAGCGAGCAAGAGAGGGAGAGAGAGAGAGAAGCGTTACCATAAACCACGGCATGAGCGAGACAGAGAC

AAGCCATGGGATCAGTCGGGAGTCCGTTGTGCTTAGGAAAACCCAGCAGCCATTAGCTGGGGGAGCATGTTCGGCTCTGTCCCCCAAGCACCTTTCTGAG

GAGGACACAGGATGTTGAACTCTGCTTCACGGGCAGAGCTTCTAATGACAGATACTGGCTTGCACTGGAAAGACAGTTCCCACGGGACCTGGACGGACAA

CACATCCTACATTCAGACATTGTGGTCGGGCACGGTGACAGAGTTGATCCGTTTCTCAAGTGTTATCTACCAAGCTTTTGTGAAGTTCCATCGAAGGAGG

TAGATTCTTGCTCAGATATAATTTCAGGAAAACCCGAGTCCTTGACAAAGACAGGAGACGCTCTCAATTTGGAGGCAAGTTTCTCTTACCTTGAACTTTT

TCAGACAGCAACTCCGCCCAGCCCCCATCTTCCACTCTCACCTGTCTTGTAACTGTGCAAACAAAAGTGTGCATGGTCTTTGTCAATTGATACCTATGTG

CACGTGTGCAGAAACTGTTGTTCCAGCTGGGGTGTCTGATTAGGAGGGCAGATCCATAAAAGGTCTAACCTAGGCAACTTCGGGAAAGGAGACCAGATCA

GTAGCTGGAGGCACTCTCCAGTAGGCGGTGAGGGGTTTACTGAGTAGGCATGCTGAAGCCCGGATATTCACCCATCTCAAACCCCCCGGGCTGCAGGACA

GGCACAGGCCATCCCTGAGGAGAAGGGGAGCCCTTTTGGGATACCACCTGAGGTTATGTTCAGTGTGCTCTGGTCAAGTCCCTTGCTCGGGGCTCTGTTT

GGGGAGAGTGGTTTCATTCCAAGGTACTCATTATTAGTATGCTGTTTTGTTAACTATACTCCATTAAAAAGTTAAAAAAAAAAAGAATTAAGCCTTGACA

CTGTATGGCTGACAGGAGGCTGTGCCCAGACTGAGCCTGGAGATTTGCGCCCGCACATGGTCATTGGTTTTCCGAAAAGAGAGGGTAAATTTATATAGAA

ATTTACAGGTATTTGGGTAGTCATTTAGACCGAGGGAGACCAGTGTTTCCATTTCTCTGCGCCCCCTCTGTGAGGGGAAGTTCGATACACTTGACACCTT

TATAAACGGAGCCAGATAGGAAGGGAGTGACTTAATTCACCTTAGAACATTTCATTTGGTGTTTATTTCTGAAGGTGCAAGAGCTCTGTGTAGGTTTCAT

TTGTGCCCGAGCATTTCTGGAGCACTGTGTTTTCTAGCAGAAACTCCGAGAGCCAGTTCTCACAATGAAACTTTAAAACCTGTGTAAATTGACAGAGAGC

AGAAGGCGATCCAAGAGGCCCACTCAAGTGAGTGGTGGCACGAGGCACATGCGGTGGCCCTTTCTGTTGTGCTGGCCCATGAGAGATGGGAGCTATTTTG

TCCTCTTCGTCCATTAAAACAAACCCCTCCAGAATACCTATAGTAATATAATGAAAGCCATATCTCTGTGATCTATACCGTCAGGTATAGATCATTAAAG

GACCCATGGTACTGTCAGGCACTGTGGAACCGTGAGGCAGCGGAAAGGCAAGGGCACATTTGTACATGTTCCTCTAGCTTCCGCCAGCCGTGACCTATGA

ACTCACATAGGCCGGTTGCTCCTAGTCTGACGGGCTGCCCTGGGAGGAAAAGCTGCAAGATGCTCAGCAGAGAGCAAAGGAGAGGATAGTCTTGGAAAAG

GCCAAGGTTGGGGATGCCATACAGGATTACACCAAAGGGCTGTACTGAGAATGTGGGAGCATTCCATTCCAGGTTTGTATTTTCCTCAGCAAGAAAAAAG

AGCAGATAGAAGGGCAGAGGAGGATAGAGAGGAAGAGAAAGGAGAGGGAGAAGAGAGCAGAGAAGAGAGAGAGAGAGAGAGAGAGAGAGAATCTTTATAC

TTTTTGGCAAGTCCTCGAAGGTCTCAAAATGAAAGTGTCTATGCAAGTGCAAATTTTTACAGTTATTTATACTAATTATTATTATTGTTATTAATTATTA

TTATTACTAGTCTGTTGTCTCAAGAATATGTGCAGATTTCAGAGCATTAAAGAGTATTTGGTTTCTTTTAAAGTAGTTGGGTGAGCCAAGGACACCTTAA

AATAATTGTCACTGTTCATCTGCTATCGCCTTTCTCATGGTATTTTAAGTTTTAGAAAAGAAACATTCTTGTTCTAAAACATATCCCTCTCCATAGATGA

CAAAAAAAAATGGTGTTAGCAAACCGAAACCTCCCCCGATTCCTGTCTGACATCCGATCCATTTCTCAACTGCTTGATGATTTCCGAGCGCTTTTTGCAT

ATGTTGTCAAAATATTCATATTATTTTGGTGAGGGAATGGAGACTCAGAAACTCAGAGGACAAACATAAGCTTCACCGAAGTCTGTCTGCCAGATACAAA

CTAACATACAAACAAGACAGCCGGGAAGGAAATGTGCTGGTAGCGTGTCTGTGGAGCAGGGTGGGGGTTAGAACAGAAGGAGACCTGGGCAGTGCACGCA

GAAGAGATGTTACATCATGTGCTTCTGCTCCTGGCTTCTGCTGACTCCCAACTTTGCGCTCAGCCTCATTTAGAAAACGCTTCAAACACTGCTCTTCAGG

GTTCTGTCAGAACTCACACACACGTGCTCACACCAGCCCCGCTTGTGACGTTTTTATGTACTTCTATATAAATATATACATAATATATGTTATAAACACT

TGATTTATACATATACAAATGCACACATGTAGTGTGTTTGTGTGTTTATGTATAAACATATAGGCTCATGGTAATAGAATAATTATAAGTAGGGTGCAAT

ATGAATAATTTGCTTAATATTTGCTAAGTAACCAAAACTTTCCAACGTCATGTGGCAGTTCATATTTCCACTCTCAGTGTGGGTAAGGATGGGCTACACC

ACACTTTCAGCTCTGTGCAGCCCTTGGATGGAAGATGTGTTGAAAAAAAAATCACATCTTCCCTGAAACAACTGACTGAAAGCCATCCTCTACATTGAAT

CTGTTCTCTGGCTCTTTGCAAAGGAGAAATGCAGACAAATGGTCTCCTTGTGTCCCAGTCCTGGGAAGGAGAAGTGGGTTTTCTCTTCTTGCACATTTGG

GCCGTGCTCACCTTTCCTGGCTCTATGCCCTTTACACTGGGCTCAGAGATGAAGCAGTCTAGACCCAAGCTGCAGGGCTGTAGGGAGGCAAATGTCTTCG

AGGCTGATAGCAAAGCATCCAAAAATCTATAGCAAGATGCGCAGCTTGAAGTCACTCCTCATCCACACGGCAAGCAAGAGCCAGGGCATGCAGTGCTGTC

CATCTCTAGGACTGGGCAGTGGGGTCCCCGGTCAAGGGCAGTCTTTCCCTAAGCCTCTCCTTTTGCAAATGGCACTGCCAGCAGTACCTGGCATTAAGTC

ACGAAAAATTTCTAAAATGGCAGCACAGACCCGTGTGCCCTCATTGCTCTGCCCCCACATGCCTCATCATTAGAGGGCTCCAGTTTTCAAACTTGACTTT

CCATTTGGCCCTGTATCGTGGTTAAAGGAAATCTCAACAGAGGGATGGCCAATTGACCTAAATCCCCAGATGTCCAAGTTTGCAGTGAAAGCCAGTTCTT

CCCAAATGTATAACTGGAATGTAGGGACTCAGGTTGTGATACTTCATACAGGAATCTCAGATGTTATTGTAAAGAACTGGGTTGGGAGGGATTCATCACT

AAGCCAACAATAATGCAGGAGGGCGTGGCTGATCGTTAAGCCAATAGTAGTGCAGGAGGGCGTGGCTGCTGTGAGGGCTGGAATCCATCTCTGCTGCTAA

AGTTCAGGGTTCTCAACTCTTTTCAGCTGTTGCAGCCCTTCACTTCTTTCCCTTCGGCGTTATTTATTTGTGTATTTATTTATTTATTTATTTATTTATC

TATCTATCTATCAACTTTTGGTCCATTCATCACCAACATAAAGCAAAAACAATTTTTTACATATATGTAAATGTGTTGCAAGTGAAACACTGTGAATCTC

ACAACCACCTCCTAGCAACTATGCTGCCATCTTGACGTGCGTCTCAGGAGTCGAGACGGGAAAAGACGAGGACGTCATTTTGCAGCCTACGCATTCTGGG

CCAGGTCCGTGTTCGTTTTATTTCTTTAGTCTGTGAGTTAAGAAAACAATCCGAGTGGAGGGTGACGGATGTTCGGCAAGTTCGGTGAAGCAGCACGAGC

TCTTTGCAGCTATAGGTTCGAGCAAGAAGAAAAACCATGGGAGATGGAGAAGGGAAATTTGATGGAGGGGTGGGGTGGGGTGGGGGCTCTGTCTTACAGC

TCGTGTAGCTTACTGTTGCTTAAAAATGTATACAACAGCTGGAAATGTTTTCAACACAAGGTATTTGAAATAAATGTGAATCTTAAATATGTACTCCCTT

AAGGAATGAACATATTATGGTGAAATATTGCTCCCCCGCGTCCCCTACAAATCTGCCTAGAGATGTGGATACCTACATTTGCTTAAGCATCAGACCAGTG

TTTGTATATACCCGGGCCATACACACTCATCTCGACGTCTCTCTGCGGATGTATTTCCCCTTCACTGGTGACCTGGTATTTAGAACTCCGTCTTTTCAGT

TGGTTTATTTCCCTTTAATGTGATGTCTCTGTGCCGATTATTACCGGTTCTTACTTGTTTTTGCAATCCGTTTTGAGGTCCAGTGTTTTACTGAGACTCA

TTGCATCTTGGCTGATTTCAAAGTGACACCCGAATACAGTGTTTAAAAAAAAAGTTTGTTTGTAAATCATGTGACCAGCTTCTCTCACCCTGACATGGAA

TGTCTCTTGTACTACAGTGTATTTAATAATAAAAGAAAAAAATGATGTCTTACAATAAATAACATCTTCCACAAGAGG
Translation
 MSPWLKWHGPAMARLWGLCLLVLGFWRASLACPTSCKCSSARIWCTEPSPGIVAFPRLEPNSVDPENITEM MILTGNPFTCSCDIMWLKTLQETKSSP

DTQDLYCLNESSKNMPLANLQIPNCG GLPSARLAAPNLTVEEGKSVTLSCSVGGDPLPTLYWDVGNLVSKHM NETSHTQGSLRITNISSDDSGKQISC

VAENLVGEDQDSVNLTVHF FAPTITFLESPTSDHHWCIPFTVRGNPKPALQWFYNGAILNESKYICTKIHVTNHTEYHGCLQLDNPTHMNNGDYTLMAK

NEYGKDERQISAHFMGRPGVDYE ETNPNYPEVLYE DWTTPTDIGDTTNKSNEIPSTDVADQSNREHLS VYAVVVIASVVGFCLLVMLLLLKLARHSK

FGMKG - UNI13941 - - UNI33589 - GPASVISNDDDSASPLHHISNGSNTPSSSEGGPDAVIIGMTKIPVIENPQYFGITNSQLKPDTF FVQ

HIKRHNIVLKRELGEGAFGKVFLAECYNLCPEQDKILVAVK TLKDASDNARKDFHREAELLTNLQHEHIVKFYGVCVEGDPLIMVFEYMKHGDLNKFLR

 RAHGPDAVLMAEGNPPTELTQSQMLHIAQQIAAGMVYLASQHFVHRDLATRNCLVGENLLVKIGDFGMSRDVYSTDYYR - UNI33671 - VGGHTM

LPIRWMPPESIMYRKFTTESDVWSLGVVLWEIFTYGKQPWYQLSNNE VIECITQGRVLQRPRTCPQEVYELMLGCWQREPHTRKNIKSIHTLLQNLAKA

SPVYLDILG
Transcript ENSMUST00000109840
Sequence
GCTGCTTCTGCAGCGCTCTGCTCCCTGCGCTTGCTACGGGAGGCCGGGGAAGCCGCGCGGACAGTCCTCGGTGGCCTGGGCCGGCACTGTCCTGCTACCG

CAGTTGCTCCCCAG CCCTGAGGTGCGCACCGATATCGATATTCGTGCCGGTTTAGCGGTTCTGCGACCCAAAGAGTCCAGGGAGATCCACCGAGTGGTG

CCTGGCGTATAGGACTATGCAGCCGCCTTGTGGCTCGGAGCAGCGGCCCGCGATGTCCCAGCCACTGTGAACCATTTGGTCAGCGCCAACCTGCTCAGCC

CCAGCACCGACAGGCTCAGCCTCTGGTACGCTCCACTCCGCGGGAGGCCACCAGCACCAAGCAGCAAGAGGGCGCAGGGAAGGCCTCCCCCCTCCGGCGG

GGGACGCCTGGCTCAGCGTAGGGACACGCACTCCGACTGACTGGCACTGGCAGCTCGGGATGTCGCCCTGGCTGAAGTGGCATGGACCCGCCATGGCGCG

GCTCTGGGGCTTATGCCTGCTGGTCTTGGGCTTCTGGAGGGCCTCTCTCGCCTGCCCGACGTCCTGCAAATGCAGTTCCGCTAGGATTTGGTGTACTGAG

CCTTCTCCAGGCATCGTGGCATTCCCGAGGTTGGAACCTAACAGCGTTGACCCGGAGAACATCACGGAAAT AAATTTCACACGAAACAAGCTGACGAGT

TTGTCCAGGAGACATTTCCGCCACCTTGACTTGTCTGACCT GATCCTGACGGGTAATCCGTTCACGTGCTCCTGCGACATCATGTGGCTCAAGACTCTC

CAGGAGACTAAATCCAGCCCCGACACTCAGGATTTGTACTGCCTCAATGAGAGCAGCAAGAACATGCCCCTGGCGAACCTGCAGATACCCAATTGTG GT

CTGCCATCTGCACGTCTGGCTGCTCCTAACCTCACCGTGGAGGAAGGAAAGTCTGTGACCCTTTCCTGCAGTGTGGGGGGTGACCCACTCCCCACCTTGT

ACTGGGACGTTGGGAATTTGGTTTCCAAGCACATG AATGAAACAAGCCACACACAGGGCTCCTTAAGGATAACGAACATTTCATCTGATGACAGTGGAA

AGCAAATCTCTTGTGTGGCAGAAAACCTTGTAGGAGAAGATCAAGATTCTGTGAACCTCACTGTGCATT TTGCGCCAACTATCACGTTTCTCGAGTCTC

CAACCTCAGATCACCACTGGTGCATTCCATTCACTGTGAGAGGCAACCCCAAGCCTGCGCTTCAGTGGTTCTACAATGGGGCCATACTGAATGAGTCCAA

GTACATCTGTACTAAGATCCACGTCACCAATCACACGGAGTACCATGGCTGCCTCCAGCTGGATAACCCCACTCATATGAATAACGGAGACTACACCCTG

ATGGCCAAGAACGAGTATGGGAAGGATGAGAGACAGATCTCCGCTCACTTCATGGGCCGGCCTGGAGTCGACTACG AGACAAACCCAAATTACCCTGAA

GTCCTCTATGAA GACTGGACCACGCCAACTGACATTGGGGATACTACGAACAAAAGTAATGAAATCCCCTCCACGGATGTTGCTGACCAAAGCAATCGG

GAGCATCTCTCG GTCTATGCCGTGGTGGTGATTGCATCTGTGGTGGGATTCTGCCTGCTGGTGATGTTGCTCCTGCTCAAGTTGGCGAGACATTCCAAG

TTTGGCATGAAAG - UNI13941 - - UNI33589 - GCCCAGCTTCGGTCATCAGCAACGACGATGACTCTGCCAGCCCCCTCCACCACATCTCCA

ATGGGAGTAACACTCCATCTTCTTCGGAGGGCGGTCCCGACGCTGTCATTATTGGAATGACCAAGATTCCTGTTATTGAAAACCCCCAGTACTTTGGCAT

CACCAACAGTCAGCTCAAGCCAGACACAT TTGTTCAGCATATCAAGAGACACAACATCGTTCTGAAGAGGGAACTTGGGGAAGGAGCCTTCGGGAAAGT

TTTCCTTGCCGAGTGCTACAACCTCTGCCCAGAGCAGGATAAGATCCTGGTGGCTGTGAAG ACGCTGAAGGACGCCAGCGACAATGCACGCAAGGACTT

TCATCGGGAAGCTGAGCTGCTGACCAACCTCCAGCACGAGCACATTGTCAAGTTCTACGGTGTCTGTGTGGAGGGCGACCCACTCATCATGGTCTTTGAG

TACATGAAGCACGGGGACCTCAACAAGTTCCTTAG GGCACACGGGCCCGACGCAGTGCTGATGGCAGAGGGTAACCCGCCCACAGAGCTGACGCAGTCG

CAGATGCTGCACATCGCTCAGCAAATCGCAGCAGGTATGGTCTACCTGGCGTCCCAACACTTTGTGCACCGTGACCTGGCCACCCGGAACTGCCTGGTGG

GAGAGAACCTGCTGGTGAAAATTGGGGACTTTGGGATGTCCCGAGATGTGTACAGCACCGACTACTATCGG - UNI33671 - GTCGGTGGCCACACA

ATGTTGCCCATCCGATGGATGCCTCCAGAGAGCATCATGTACAGGAAATTCACCACCGAGAGCGACGTCTGGAGCCTGGGCGTTGTGTTGTGGGAGATCT

TCACCTACGGCAAGCAGCCCTGGTATCAGCTATCGAACAATGAG GTGATAGAGTGCATCACCCAGGGAAGAGTCCTTCAGCGGCCTCGAACGTGTCCCC

AGGAGGTGTATGAGCTCATGCTTGGATGCTGGCAGCGGGAACCACACACCCGGAAGAACATCAAGAGCATCCACACCCTCCTTCAGAACTTGGCCAAGGC

ATCTCCCGTCTACCTGGATATCCTAGGCTAGGGTCCTCCTTCTGCCCAGACCGTCCTTCCCAAGGCCCTCCTCAGACTGGCCTACACGACGAACCTCTTG

ACTGCCGCTGACGTCATGACCTTGCTGTCCTTCGCTCTGACAGTGTTGACAGGACCAGGAGCGGCTCTTTGGGGGAGGCAGTGTGTGCTTCTCCATCCAC

AGACAGTATTAACTCGCTTCTGGCATTGTCTCTTTCTCTCCCTTGGGTTTGTTTCTTTCTTTTGCCCCTTCCCCTTTTATCATTATTTATTCATTTATTT

ATTTTCTGGTCTTCACCGCTTCACGGCCCTCAGTCTCTCCTTGACCAATCTGGCTTCTGCATTCCTATTAACTGTACATAGACAAAGGCCTTAACAAACC

TAATTTGTTATATCAGCAGACACTCCAGTTTGCCCACCACAACTAACAATGCCTTGTTGTATTCCTGCCTTTGACGTGGATGAAAAAAAGGGAAAAAAAA

ATCAAACATCTGACTTAAGCTGTCACTTCCGATGTACAGACGTGGGGCGTTTCTATGGATTCACTTCTATTTATTATTTATTAATTTATTTATTTATCAC

TCTTCTTATTGTTTTCTGGTGGTTTTAACCTATGTGTGAGAAGGAAAAGTTGTGTACAATCTGGGAAAACTTTATCAGTGGGAAATGAAAACGAGAGCGA

GCAAGCGAGCAAGAGAGGGAGAGAGAGAGAGAAGCGTTACCATAAACCACGGCATGAGCGAGACAGAGACAAGCCATGGGATCAGTCGGGAGTCCGTTGT

GCTTAGGAAAACCCAGCAGCCATTAGCTGGGGGAGCATGTTCGGCTCTGTCCCCCAAGCACCTTTCTGAGGAGGACACAGGATGTTGAACTCTGCTTCAC

GGGCAGAGCTTCTAATGACAGATACTGGCTTGCACTGGAAAGACAGTTCCCACGGGACCTGGACGGACAACACATCCTACATTCAGACATTGTGGTCGGG

CACGGTGACAGAGTTGATCCGTTTCTCAAGTGTTATCTACCAAGCTTTTGTGAAGTTCCATCGAAGGAGGTAGATTCTTGCTCAGATATAATTTCAGGAA

AACCCGAGTCCTTGACAAAGACAGGAGACGCTCTCAATTTGGAGGCAAGTTTCTCTTACCTTGAACTTTTTCAGACAGCAACTCCGCCCAGCCCCCATCT

TCCACTCTCACCTGTCTTGTAACTGTGCAAACAAAAGTGTGCATGGTCTTTGTCAATTGATACCTATGTGCACGTGTGCAGAAACTGTTGTTCCAGCTGG

GGTGTCTGATTAGGAGGGCAGATCCATAAAAGGTCTAACCTAGGCAACTTCGGGAAAGGAGACCAGATCAGTAGCTGGAGGCACTCTCCAGTAGGCGGTG

AGGGGTTTACTGAGTAGGCATGCTGAAGCCCGGATATTCACCCATCTCAAACCCCCCGGGCTGCAGGACAGGCACAGGCCATCCCTGAGGAGAAGGGGAG

CCCTTTTGGGATACCACCTGAGGTTATGTTCAGTGTGCTCTGGTCAAGTCCCTTGCTCGGGGCTCTGTTTGGGGAGAGTGGTTTCATTCCAAGGTACTCA

TTATTAGTATGCTGTTTTGTTAACTATACTCCATTAAAAAGTTAAAAAAAAAAAGAATTAAGCCTTGACACTGTATGGCTGACAGGAGGCTGTGCCCAGA

CTGAGCCTGGAGATTTGCGCCCGCACATGGTCATTGGTTTTCCGAAAAGAGAGGGTAAATTTATATAGAAATTTACAGGTATTTGGGTAGTCATTTAGAC

CGAGGGAGACCAGTGTTTCCATTTCTCTGCGCCCCCTCTGTGAGGGGAAGTTCGATACACTTGACACCTTTATAAACGGAGCCAGATAGGAAGGGAGTGA

CTTAATTCACCTTAGAACATTTCATTTGGTGTTTATTTCTGAAGGTGCAAGAGCTCTGTGTAGGTTTCATTTGTGCCCGAGCATTTCTGGAGCACTGTGT

TTTCTAGCAGAAACTCCGAGAGCCAGTTCTCACAATGAAACTTTAAAACCTGTGTAAATTGACAGAGAGCAGAAGGCGATCCAAGAGGCCCACTCAAGTG

AGTGGTGGCACGAGGCACATGCGGTGGCCCTTTCTGTTGTGCTGGCCCATGAGAGATGGGAGCTATTTTGTCCTCTTCGTCCATTAAAACAAACCCCTCC

AGAATACCTATAGTAATATAATGAAAGCCATATCTCTGTGATCTATACCGTCAGGTATAGATCATTAAAGGACCCATGGTACTGTCAGGCACTGTGGAAC

CGTGAGGCAGCGGAAAGGCAAGGGCACATTTGTACATGTTCCTCTAGCTTCCGCCAGCCGTGACCTATGAACTCACATAGGCCGGTTGCTCCTAGTCTGA

CGGGCTGCCCTGGGAGGAAAAGCTGCAAGATGCTCAGCAGAGAGCAAAGGAGAGGATAGTCTTGGAAAAGGCCAAGGTTGGGGATGCCATACAGGATTAC

ACCAAAGGGCTGTACTGAGAATGTGGGAGCATTCCATTCCAGGTTTGTATTTTCCTCAGCAAGAAAAAAGAGCAGATAGAAGGGCAGAGGAGGATAGAGA

GGAAGAGAAAGGAGAGGGAGAAGAGAGCAGAGAAGAGAGAGAGAGAGAGAGAGAGAGAGAATCTTTATACTTTTTGGCAAGTCCTCGAAGGTCTCAAAAT

GAAAGTGTCTATGCAAGTGCAAATTTTTACAGTTATTTATACTAATTATTATTATTGTTATTAATTATTATTATTACTAGTCTGTTGTCTCAAGAATATG

TGCAGATTTCAGAGCATTAAAGAGTATTTGGTTTCTTTTAAAGTAGTTGGGTGAGCCAAGGACACCTTAAAATAATTGTCACTGTTCATCTGCTATCGCC

TTTCTCATGGTATTTTAAGTTTTAGAAAAGAAACATTCTTGTTCTAAAACATATCCCTCTCCATAGATGACAAAAAAAAATGGTGTTAGCAAACCGAAAC

CTCCCCCGATTCCTGTCTGACATCCGATCCATTTCTCAACTGCTTGATGATTTCCGAGCGCTTTTTGCATATGTTGTCAAAATATTCATATTATTTTGGT

GAGGGAATGGAGACTCAGAAACTCAGAGGACAAACATAAGCTTCACCGAAGTCTGTCTGCCAGATACAAACTAACATACAAACAAGACAGCCGGGAAGGA

AATGTGCTGGTAGCGTGTCTGTGGAGCAGGGTGGGGGTTAGAACAGAAGGAGACCTGGGCAGTGCACGCAGAAGAGATGTTACATCATGTGCTTCTGCTC

CTGGCTTCTGCTGACTCCCAACTTTGCGCTCAGCCTCATTTAGAAAACGCTTCAAACACTGCTCTTCAGGGTTCTGTCAGAACTCACACACACGTGCTCA

CACCAGCCCCGCTTGTGACGTTTTTATGTACTTCTATATAAATATATACATAATATATGTTATAAACACTTGATTTATACATATACAAATGCACACATGT

AGTGTGTTTGTGTGTTTATGTATAAACATATAGGCTCATGGTAATAGAATAATTATAAGTAGGGTGCAATATGAATAATTTGCTTAATATTTGCTAAGTA

ACCAAAACTTTCCAACGTCATGTGGCAGTTCATATTTCCACTCTCAGTGTGGGTAAGGATGGGCTACACCACACTTTCAGCTCTGTGCAGCCCTTGGATG

GAAGATGTGTTGAAAAAAAAATCACATCTTCCCTGAAACAACTGACTGAAAGCCATCCTCTACATTGAATCTGTTCTCTGGCTCTTTGCAAAGGAGAAAT

GCAGACAAATGGTCTCCTTGTGTCCCAGTCCTGGGAAGGAGAAGTGGGTTTTCTCTTCTTGCACATTTGGGCCGTGCTCACCTTTCCTGGCTCTATGCCC

TTTACACTGGGCTCAGAGATGAAGCAGTCTAGACCCAAGCTGCAGGGCTGTAGGGAGGCAAATGTCTTCGAGGCTGATAGCAAAGCATCCAAAAATCTAT

AGCAAGATGCGCAGCTTGAAGTCACTCCTCATCCACACGGCAAGCAAGAGCCAGGGCATGCAGTGCTGTCCATCTCTAGGACTGGGCAGTGGGGTCCCCG

GTCAAGGGCAGTCTTTCCCTAAGCCTCTCCTTTTGCAAATGGCACTGCCAGCAGTACCTGGCATTAAGTCACGAAAAATTTCTAAAATGGCAGCACAGAC

CCGTGTGCCCTCATTGCTCTGCCCCCACATGCCTCATCATTAGAGGGCTCCAGTTTTCAAACTTGACTTTCCATTTGGCCCTGTATCGTGGTTAAAGGAA

ATCTCAACAGAGGGATGGCCAATTGACCTAAATCCCCAGATGTCCAAGTTTGCAGTGAAAGCCAGTTCTTCCCAAATGTATAACTGGAATGTAGGGACTC

AGGTTGTGATACTTCATACAGGAATCTCAGATGTTATTGTAAAGAACTGGGTTGGGAGGGATTCATCACTAAGCCAACAATAATGCAGGAGGGCGTGGCT

GATCGTTAAGCCAATAGTAGTGCAGGAGGGCGTGGCTGCTGTGAGGGCTGGAATCCATCTCTGCTGCTAAAGTTCAGGGTTCTCAACTCTTTTCAGCTGT

TGCAGCCCTTCACTTCTTTCCCTTCGGCGTTATTTATTTGTGTATTTATTTATTTATTTATTTATTTATCTATCTATCTATCAACTTTTGGTCCATTCAT

CACCAACATAAAGCAAAAACAATTTTTTACATATATGTAAATGTGTTGCAAGTGAAACACTGTGAATCTCACAACCACCTCCTAGCAACTATGCTGCCAT

CTTGACGTGCGTCTCAGGAGTCGAGACGGGAAAAGACGAGGACGTCATTTTGCAGCCTACGCATTCTGGGCCAGGTCCGTGTTCGTTTTATTTCTTTAGT

CTGTGAGTTAAGAAAACAATCCGAGTGGAGGGTGACGGATGTTCGGCAAGTTCGGTGAAGCAGCACGAGCTCTTTGCAGCTATAGGTTCGAGCAAGAAGA

AAAACCATGGGAGATGGAGAAGGGAAATTTGATGGAGGGGTGGGGTGGGGTGGGGGCTCTGTCTTACAGCTCGTGTAGCTTACTGTTGCTTAAAAATGTA

TACAACAGCTGGAAATGTTTTCAACACAAGGTATTTGAAATAAATGTGAATCTTAAATATGTACTCCCTTAAGGAATGAACATATTATGGTGAAATATTG

CTCCCCCGCGTCCCCTACAAATCTGCCTAGAGATGTGGATACCTACATTTGCTTAAGCATCAGACCAGTGTTTGTATATACCCGGGCCATACACACTCAT

CTCGACGTCTCTCTGCGGATGTATTTCCCCTTCACTGGTGACCTGGTATTTAGAACTCCGTCTTTTCAGTTGGTTTATTTCCCTTTAATGTGATGTCTCT

GTGCCGATTATTACCGGTTCTTACTTGTTTTTGCAATCCGTTTTGAGGTCCAGTGTTTTACTGAGACTCATTGCATCTTGGCTGATTTCAAAGTGACACC

CGAATACAGTGTTTAAAAAAAAAGTTTGTTTGTAAATCATGTGACCAGCTTCTCTCACCCTGACATGGAATGTCTCTTGTACTACAGTGTATTTAATAAT

AAAAGAAAAAAATGATGTCTTACAATAAATAACATCTTCCACAAGAGG
Translation
 MSPWLKWHGPAMARLWGLCLLVLGFWRASLACPTSCKCSSARIWCTEPSPGIVAFPRLEPNSVDPENITEI INFTRNKLTSLSRRHFRHLDLSDL LI

LTGNPFTCSCDIMWLKTLQETKSSPDTQDLYCLNESSKNMPLANLQIPNCG GLPSARLAAPNLTVEEGKSVTLSCSVGGDPLPTLYWDVGNLVSKHM N

ETSHTQGSLRITNISSDDSGKQISCVAENLVGEDQDSVNLTVHF FAPTITFLESPTSDHHWCIPFTVRGNPKPALQWFYNGAILNESKYICTKIHVTNH

TEYHGCLQLDNPTHMNNGDYTLMAKNEYGKDERQISAHFMGRPGVDYE ETNPNYPEVLYE DWTTPTDIGDTTNKSNEIPSTDVADQSNREHLS VYAV

VVIASVVGFCLLVMLLLLKLARHSKFGMKG - UNI13941 - - UNI33589 - GPASVISNDDDSASPLHHISNGSNTPSSSEGGPDAVIIGMTKI

PVIENPQYFGITNSQLKPDTF FVQHIKRHNIVLKRELGEGAFGKVFLAECYNLCPEQDKILVAVK TLKDASDNARKDFHREAELLTNLQHEHIVKFYG

VCVEGDPLIMVFEYMKHGDLNKFLR RAHGPDAVLMAEGNPPTELTQSQMLHIAQQIAAGMVYLASQHFVHRDLATRNCLVGENLLVKIGDFGMSRDVYS

TDYYR - UNI33671 - VGGHTMLPIRWMPPESIMYRKFTTESDVWSLGVVLWEIFTYGKQPWYQLSNNE VIECITQGRVLQRPRTCPQEVYELMLG

CWQREPHTRKNIKSIHTLLQNLAKASPVYLDILG
Transcript ENSMUST00000079828
Sequence
GCTGCTTCTGCAGCGCTCTGCTCCCTGCGCTTGCTACGGGAGGCCGGGGAAGCCGCGCGGACAGTCCTCGGTGGCCTGGGCCGGCACTGTCCTGCTACCG

CAGTTGCTCCCCAG CCCTGAGGTGCGCACCGATATCGATATTCGTGCCGGTTTAGCGGTTCTGCGACCCAAAGAGTCCAGGGAGATCCACCGAGTGGTG

CCTGGCGTATAGGACTATGCAGCCGCCTTGTGGCTCGGAGCAGCGGCCCGCGATGTCCCAGCCACTGTGAACCATTTGGTCAGCGCCAACCTGCTCAGCC

CCAGCACCGACAGGCTCAGCCTCTGGTACGCTCCACTCCGCGGGAGGCCACCAGCACCAAGCAGCAAGAGGGCGCAGGGAAGGCCTCCCCCCTCCGGCGG

GGGACGCCTGGCTCAGCGTAGGGACACGCACTCCGACTGACTGGCACTGGCAGCTCGGGATGTCGCCCTGGCTGAAGTGGCATGGACCCGCCATGGCGCG

GCTCTGGGGCTTATGCCTGCTGGTCTTGGGCTTCTGGAGGGCCTCTCTCGCCTGCCCGACGTCCTGCAAATGCAGTTCCGCTAGGATTTGGTGTACTGAG

CCTTCTCCAGGCATCGTGGCATTCCCGAGGTTGGAACCTAACAGCGTTGACCCGGAGAACATCACGGAAAT TCTCATTGCAAACCAGAAAAGGCTAGAA

ATCATCAATGAAGATGACGTTGAAGCTTACGTGGGGCTGAGAAACCT TACAATTGTGGATTCCGGCTTAAAGTTTGTGGCTTACAAAGCGTTTCTGAAA

AACAGCAACCTGCGGCACAT AAATTTCACACGAAACAAGCTGACGAGTTTGTCCAGGAGACATTTCCGCCACCTTGACTTGTCTGACCT GATCCTGAC

GGGTAATCCGTTCACGTGCTCCTGCGACATCATGTGGCTCAAGACTCTCCAGGAGACTAAATCCAGCCCCGACACTCAGGATTTGTACTGCCTCAATGAG

AGCAGCAAGAACATGCCCCTGGCGAACCTGCAGATACCCAATTGTG GTCTGCCATCTGCACGTCTGGCTGCTCCTAACCTCACCGTGGAGGAAGGAAAG

TCTGTGACCCTTTCCTGCAGTGTGGGGGGTGACCCACTCCCCACCTTGTACTGGGACGTTGGGAATTTGGTTTCCAAGCACATG AATGAAACAAGCCAC

ACACAGGGCTCCTTAAGGATAACGAACATTTCATCTGATGACAGTGGAAAGCAAATCTCTTGTGTGGCAGAAAACCTTGTAGGAGAAGATCAAGATTCTG

TGAACCTCACTGTGCATT TTGCGCCAACTATCACGTTTCTCGAGTCTCCAACCTCAGATCACCACTGGTGCATTCCATTCACTGTGAGAGGCAACCCCA

AGCCTGCGCTTCAGTGGTTCTACAATGGGGCCATACTGAATGAGTCCAAGTACATCTGTACTAAGATCCACGTCACCAATCACACGGAGTACCATGGCTG

CCTCCAGCTGGATAACCCCACTCATATGAATAACGGAGACTACACCCTGATGGCCAAGAACGAGTATGGGAAGGATGAGAGACAGATCTCCGCTCACTTC

ATGGGCCGGCCTGGAGTCGACTACG AGACAAACCCAAATTACCCTGAAGTCCTCTATGAAG ACTGGACCACGCCAACTGACATTGGGGATACTACGAA

CAAAAGTAATGAAATCCCCTCCACGGATGTTGCTGACCAAAGCAATCGGGAGCATCTCTCG GTCTATGCCGTGGTGGTGATTGCATCTGTGGTGGGATT

CTGCCTGCTGGTGATGTTGCTCCTGCTCAAGTTGGCGAGACATTCCAAGTTTGGCATGAAAG - UNI13941 - - UNI33589 - GCCCAGCTTCG

GTCATCAGCAACGACGATGACTCTGCCAGCCCCCTCCACCACATCTCCAATGGGAGTAACACTCCATCTTCTTCGGAGGGCGGTCCCGACGCTGTCATTA

TTGGAATGACCAAGATTCCTGTTATTGAAAACCCCCAGTACTTTGGCATCACCAACAGTCAGCTCAAGCCAGACACAT TTGTTCAGCATATCAAGAGAC

ACAACATCGTTCTGAAGAGGGAACTTGGGGAAGGAGCCTTCGGGAAAGTTTTCCTTGCCGAGTGCTACAACCTCTGCCCAGAGCAGGATAAGATCCTGGT

GGCTGTGAAG ACGCTGAAGGACGCCAGCGACAATGCACGCAAGGACTTTCATCGGGAAGCTGAGCTGCTGACCAACCTCCAGCACGAGCACATTGTCAA

GTTCTACGGTGTCTGTGTGGAGGGCGACCCACTCATCATGGTCTTTGAGTACATGAAGCACGGGGACCTCAACAAGTTCCTTAG GGCACACGGGCCCGA

CGCAGTGCTGATGGCAGAGGGTAACCCGCCCACAGAGCTGACGCAGTCGCAGATGCTGCACATCGCTCAGCAAATCGCAGCAGGTATGGTCTACCTGGCG

TCCCAACACTTTGTGCACCGTGACCTGGCCACCCGGAACTGCCTGGTGGGAGAGAACCTGCTGGTGAAAATTGGGGACTTTGGGATGTCCCGAGATGTGT

ACAGCACCGACTACTATCGG - UNI33671 - GTCGGTGGCCACACAATGTTGCCCATCCGATGGATGCCTCCAGAGAGCATCATGTACAGGAAATTC

ACCACCGAGAGCGACGTCTGGAGCCTGGGCGTTGTGTTGTGGGAGATCTTCACCTACGGCAAGCAGCCCTGGTATCAGCTATCGAACAATGAG GTGATA

GAGTGCATCACCCAGGGAAGAGTCCTTCAGCGGCCTCGAACGTGTCCCCAGGAGGTGTATGAGCTCATGCTTGGATGCTGGCAGCGGGAACCACACACCC

GGAAGAACATCAAGAGCATCCACACCCTCCTTCAGAACTTGGCCAAGGCATCTCCCGTCTACCTGGATATCCTAGGCTAGGGTCCTCCTTCTGCCCAGAC

CGTCCTTCCCAAGGCCCTCCTCAGACTGGCCTACACGACGAACCTCTTGACTGCCGCTGACGTCATGACCTTGCTGTCCTTCGCTCTGACAGTGTTGACA

GGACCAGGAGCGGCTCTTTGGGGGAGGCAGTGTGTGCTTCTCCATCCACAGACAGTATTAACTCGCTTCTGGCATTGTCTCTTTCTCTCCCTTGGGTTTG

TTTCTTTCTTTTGCCCCTTCCCCTTTTATCATTATTTATTCATTTATTTATTTTCTGGTCTTCACCGCTTCACGGCCCTCAGTCTCTCCTTGACCAATCT

GGCTTCTGCATTCCTATTAACTGTACATAGACAAAGGCCTTAACAAACCTAATTTGTTATATCAGCAGACACTCCAGTTTGCCCACCACAACTAACAATG

CCTTGTTGTATTCCTGCCTTTGACGTGGATGAAAAAAAGGGAAAAAAAAATCAAACATCTGACTTAAGCTGTCACTTCCGATGTACAGACGTGGGGCGTT

TCTATGGATTCACTTCTATTTATTATTTATTAATTTATTTATTTATCACTCTTCTTATTGTTTTCTGGTGGTTTTAACCTATGTGTGAGAAGGAAAAGTT

GTGTACAATCTGGGAAAACTTTATCAGTGGGAAATGAAAACGAGAGCGAGCAAGCGAGCAAGAGAGGGAGAGAGAGAGAGAAGCGTTACCATAAACCACG

GCATGAGCGAGACAGAGACAAGCCATGGGATCAGTCGGGAGTCCGTTGTGCTTAGGAAAACCCAGCAGCCATTAGCTGGGGGAGCATGTTCGGCTCTGTC

CCCCAAGCACCTTTCTGAGGAGGACACAGGATGTTGAACTCTGCTTCACGGGCAGAGCTTCTAATGACAGATACTGGCTTGCACTGGAAAGACAGTTCCC

ACGGGACCTGGACGGACAACACATCCTACATTCAGACATTGTGGTCGGGCACGGTGACAGAGTTGATCCGTTTCTCAAGTGTTATCTACCAAGCTTTTGT

GAAGTTCCATCGAAGGAGGTAGATTCTTGCTCAGATATAATTTCAGGAAAACCCGAGTCCTTGACAAAGACAGGAGACGCTCTCAATTTGGAGGCAAGTT

TCTCTTACCTTGAACTTTTTCAGACAGCAACTCCGCCCAGCCCCCATCTTCCACTCTCACCTGTCTTGTAACTGTGCAAACAAAAGTGTGCATGGTCTTT

GTCAATTGATACCTATGTGCACGTGTGCAGAAACTGTTGTTCCAGCTGGGGTGTCTGATTAGGAGGGCAGATCCATAAAAGGTCTAACCTAGGCAACTTC

GGGAAAGGAGACCAGATCAGTAGCTGGAGGCACTCTCCAGTAGGCGGTGAGGGGTTTACTGAGTAGGCATGCTGAAGCCCGGATATTCACCCATCTCAAA

CCCCCCGGGCTGCAGGACAGGCACAGGCCATCCCTGAGGAGAAGGGGAGCCCTTTTGGGATACCACCTGAGGTTATGTTCAGTGTGCTCTGGTCAAGTCC

CTTGCTCGGGGCTCTGTTTGGGGAGAGTGGTTTCATTCCAAGGTACTCATTATTAGTATGCTGTTTTGTTAACTATACTCCATTAAAAAGTTAAAAAAAA

AAAGAATTAAGCCTTGACACTGTATGGCTGACAGGAGGCTGTGCCCAGACTGAGCCTGGAGATTTGCGCCCGCACATGGTCATTGGTTTTCCGAAAAGAG

AGGGTAAATTTATATAGAAATTTACAGGTATTTGGGTAGTCATTTAGACCGAGGGAGACCAGTGTTTCCATTTCTCTGCGCCCCCTCTGTGAGGGGAAGT

TCGATACACTTGACACCTTTATAAACGGAGCCAGATAGGAAGGGAGTGACTTAATTCACCTTAGAACATTTCATTTGGTGTTTATTTCTGAAGGTGCAAG

AGCTCTGTGTAGGTTTCATTTGTGCCCGAGCATTTCTGGAGCACTGTGTTTTCTAGCAGAAACTCCGAGAGCCAGTTCTCACAATGAAACTTTAAAACCT

GTGTAAATTGACAGAGAGCAGAAGGCGATCCAAGAGGCCCACTCAAGTGAGTGGTGGCACGAGGCACATGCGGTGGCCCTTTCTGTTGTGCTGGCCCATG

AGAGATGGGAGCTATTTTGTCCTCTTCGTCCATTAAAACAAACCCCTCCAGAATACCTATAGTAATATAATGAAAGCCATATCTCTGTGATCTATACCGT

CAGGTATAGATCATTAAAGGACCCATGGTACTGTCAGGCACTGTGGAACCGTGAGGCAGCGGAAAGGCAAGGGCACATTTGTACATGTTCCTCTAGCTTC

CGCCAGCCGTGACCTATGAACTCACATAGGCCGGTTGCTCCTAGTCTGACGGGCTGCCCTGGGAGGAAAAGCTGCAAGATGCTCAGCAGAGAGCAAAGGA

GAGGATAGTCTTGGAAAAGGCCAAGGTTGGGGATGCCATACAGGATTACACCAAAGGGCTGTACTGAGAATGTGGGAGCATTCCATTCCAGGTTTGTATT

TTCCTCAGCAAGAAAAAAGAGCAGATAGAAGGGCAGAGGAGGATAGAGAGGAAGAGAAAGGAGAGGGAGAAGAGAGCAGAGAAGAGAGAGAGAGAGAGAG

AGAGAGAGAATCTTTATACTTTTTGGCAAGTCCTCGAAGGTCTCAAAATGAAAGTGTCTATGCAAGTGCAAATTTTTACAGTTATTTATACTAATTATTA

TTATTGTTATTAATTATTATTATTACTAGTCTGTTGTCTCAAGAATATGTGCAGATTTCAGAGCATTAAAGAGTATTTGGTTTCTTTTAAAGTAGTTGGG

TGAGCCAAGGACACCTTAAAATAATTGTCACTGTTCATCTGCTATCGCCTTTCTCATGGTATTTTAAGTTTTAGAAAAGAAACATTCTTGTTCTAAAACA

TATCCCTCTCCATAGATGACAAAAAAAAATGGTGTTAGCAAACCGAAACCTCCCCCGATTCCTGTCTGACATCCGATCCATTTCTCAACTGCTTGATGAT

TTCCGAGCGCTTTTTGCATATGTTGTCAAAATATTCATATTATTTTGGTGAGGGAATGGAGACTCAGAAACTCAGAGGACAAACATAAGCTTCACCGAAG

TCTGTCTGCCAGATACAAACTAACATACAAACAAGACAGCCGGGAAGGAAATGTGCTGGTAGCGTGTCTGTGGAGCAGGGTGGGGGTTAGAACAGAAGGA

GACCTGGGCAGTGCACGCAGAAGAGATGTTACATCATGTGCTTCTGCTCCTGGCTTCTGCTGACTCCCAACTTTGCGCTCAGCCTCATTTAGAAAACGCT

TCAAACACTGCTCTTCAGGGTTCTGTCAGAACTCACACACACGTGCTCACACCAGCCCCGCTTGTGACGTTTTTATGTACTTCTATATAAATATATACAT

AATATATGTTATAAACACTTGATTTATACATATACAAATGCACACATGTAGTGTGTTTGTGTGTTTATGTATAAACATATAGGCTCATGGTAATAGAATA

ATTATAAGTAGGGTGCAATATGAATAATTTGCTTAATATTTGCTAAGTAACCAAAACTTTCCAACGTCATGTGGCAGTTCATATTTCCACTCTCAGTGTG

GGTAAGGATGGGCTACACCACACTTTCAGCTCTGTGCAGCCCTTGGATGGAAGATGTGTTGAAAAAAAAATCACATCTTCCCTGAAACAACTGACTGAAA

GCCATCCTCTACATTGAATCTGTTCTCTGGCTCTTTGCAAAGGAGAAATGCAGACAAATGGTCTCCTTGTGTCCCAGTCCTGGGAAGGAGAAGTGGGTTT

TCTCTTCTTGCACATTTGGGCCGTGCTCACCTTTCCTGGCTCTATGCCCTTTACACTGGGCTCAGAGATGAAGCAGTCTAGACCCAAGCTGCAGGGCTGT

AGGGAGGCAAATGTCTTCGAGGCTGATAGCAAAGCATCCAAAAATCTATAGCAAGATGCGCAGCTTGAAGTCACTCCTCATCCACACGGCAAGCAAGAGC

CAGGGCATGCAGTGCTGTCCATCTCTAGGACTGGGCAGTGGGGTCCCCGGTCAAGGGCAGTCTTTCCCTAAGCCTCTCCTTTTGCAAATGGCACTGCCAG

CAGTACCTGGCATTAAGTCACGAAAAATTTCTAAAATGGCAGCACAGACCCGTGTGCCCTCATTGCTCTGCCCCCACATGCCTCATCATTAGAGGGCTCC

AGTTTTCAAACTTGACTTTCCATTTGGCCCTGTATCGTGGTTAAAGGAAATCTCAACAGAGGGATGGCCAATTGACCTAAATCCCCAGATGTCCAAGTTT

GCAGTGAAAGCCAGTTCTTCCCAAATGTATAACTGGAATGTAGGGACTCAGGTTGTGATACTTCATACAGGAATCTCAGATGTTATTGTAAAGAACTGGG

TTGGGAGGGATTCATCACTAAGCCAACAATAATGCAGGAGGGCGTGGCTGATCGTTAAGCCAATAGTAGTGCAGGAGGGCGTGGCTGCTGTGAGGGCTGG

AATCCATCTCTGCTGCTAAAGTTCAGGGTTCTCAACTCTTTTCAGCTGTTGCAGCCCTTCACTTCTTTCCCTTCGGCGTTATTTATTTGTGTATTTATTT

ATTTATTTATTTATTTATCTATCTATCTATCAACTTTTGGTCCATTCATCACCAACATAAAGCAAAAACAATTTTTTACATATATGTAAATGTGTTGCAA

GTGAAACACTGTGAATCTCACAACCACCTCCTAGCAACTATGCTGCCATCTTGACGTGCGTCTCAGGAGTCGAGACGGGAAAAGACGAGGACGTCATTTT

GCAGCCTACGCATTCTGGGCCAGGTCCGTGTTCGTTTTATTTCTTTAGTCTGTGAGTTAAGAAAACAATCCGAGTGGAGGGTGACGGATGTTCGGCAAGT

TCGGTGAAGCAGCACGAGCTCTTTGCAGCTATAGGTTCGAGCAAGAAGAAAAACCATGGGAGATGGAGAAGGGAAATTTGATGGAGGGGTGGGGTGGGGT

GGGGGCTCTGTCTTACAGCTCGTGTAGCTTACTGTTGCTTAAAAATGTATACAACAGCTGGAAATGTTTTCAACACAAGGTATTTGAAATAAATGTGAAT

CTTAAATATGTACTCCCTTAAGGAATGAACATATTATGGTGAAATATTGCTCCCCCGCGTCCCCTACAAATCTGCCTAGAGATGTGGATACCTACATTTG

CTTAAGCATCAGACCAGTGTTTGTATATACCCGGGCCATACACACTCATCTCGACGTCTCTCTGCGGATGTATTTCCCCTTCACTGGTGACCTGGTATTT

AGAACTCCGTCTTTTCAGTTGGTTTATTTCCCTTTAATGTGATGTCTCTGTGCCGATTATTACCGGTTCTTACTTGTTTTTGCAATCCGTTTTGAGGTCC

AGTGTTTTACTGAGACTCATTGCATCTTGGCTGATTTCAAAGTGACACCCGAATACAGTGTTTAAAAAAAAAGTTTGTTTGTAAATCATGTGACCAGCTT

CTCTCACCCTGACATGGAATGTCTCTTGTACTACAGTGTATTTAATAATAAAAGAAAAAAATGATGTCTTACAATAAATAACATCTTCCACAAGAGG
Translation
 MSPWLKWHGPAMARLWGLCLLVLGFWRASLACPTSCKCSSARIWCTEPSPGIVAFPRLEPNSVDPENITEI ILIANQKRLEIINEDDVEAYVGLRNL 

LTIVDSGLKFVAYKAFLKNSNLRHI INFTRNKLTSLSRRHFRHLDLSDL LILTGNPFTCSCDIMWLKTLQETKSSPDTQDLYCLNESSKNMPLANLQI

PNCG GLPSARLAAPNLTVEEGKSVTLSCSVGGDPLPTLYWDVGNLVSKHM NETSHTQGSLRITNISSDDSGKQISCVAENLVGEDQDSVNLTVHF FA

PTITFLESPTSDHHWCIPFTVRGNPKPALQWFYNGAILNESKYICTKIHVTNHTEYHGCLQLDNPTHMNNGDYTLMAKNEYGKDERQISAHFMGRPGVDY

E ETNPNYPEVLYED DWTTPTDIGDTTNKSNEIPSTDVADQSNREHLS VYAVVVIASVVGFCLLVMLLLLKLARHSKFGMKG - UNI13941 - - 

UNI33589 - GPASVISNDDDSASPLHHISNGSNTPSSSEGGPDAVIIGMTKIPVIENPQYFGITNSQLKPDTF FVQHIKRHNIVLKRELGEGAFGKV

FLAECYNLCPEQDKILVAVK TLKDASDNARKDFHREAELLTNLQHEHIVKFYGVCVEGDPLIMVFEYMKHGDLNKFLR RAHGPDAVLMAEGNPPTELT

QSQMLHIAQQIAAGMVYLASQHFVHRDLATRNCLVGENLLVKIGDFGMSRDVYSTDYYR - UNI33671 - VGGHTMLPIRWMPPESIMYRKFTTESD

VWSLGVVLWEIFTYGKQPWYQLSNNE VIECITQGRVLQRPRTCPQEVYELMLGCWQREPHTRKNIKSIHTLLQNLAKASPVYLDILG
Transcript ENSMUST00000078541
Sequence
GCTGCTTCTGCAGCGCTCTGCTCCCTGCGCTTGCTACGGGAGGCCGGGGAAGCCGCGCGGACAGTCCTCGGTGGCCTGGGCCGGCACTGTCCTGCTACCG

CAGTTGCTCCCCAG CCCTGAGGTGCGCACCGATATCGATATTCGTGCCGGTTTAGCGGTTCTGCGACCCAAAGAGTCCAGGGAGATCCACCGAGTGGTG

CCTGGCGTATAGGACTATGCAGCCGCCTTGTGGCTCGGAGCAGCGGCCCGCGATGTCCCAGCCACTGTGAACCATTTGGTCAGCGCCAACCTGCTCAGCC

CCAGCACCGACAGGCTCAGCCTCTGGTACGCTCCACTCCGCGGGAGGCCACCAGCACCAAGCAGCAAGAGGGCGCAGGGAAGGCCTCCCCCCTCCGGCGG

GGGACGCCTGGCTCAGCGTAGGGACACGCACTCCGACTGACTGGCACTGGCAGCTCGGGATGTCGCCCTGGCTGAAGTGGCATGGACCCGCCATGGCGCG

GCTCTGGGGCTTATGCCTGCTGGTCTTGGGCTTCTGGAGGGCCTCTCTCGCCTGCCCGACGTCCTGCAAATGCAGTTCCGCTAGGATTTGGTGTACTGAG

CCTTCTCCAGGCATCGTGGCATTCCCGAGGTTGGAACCTAACAGCGTTGACCCGGAGAACATCACGGAAAT TCTCATTGCAAACCAGAAAAGGCTAGAA

ATCATCAATGAAGATGACGTTGAAGCTTACGTGGGGCTGAGAAACCT TACAATTGTGGATTCCGGCTTAAAGTTTGTGGCTTACAAAGCGTTTCTGAAA

AACAGCAACCTGCGGCACAT AAATTTCACACGAAACAAGCTGACGAGTTTGTCCAGGAGACATTTCCGCCACCTTGACTTGTCTGACCT GATCCTGAC

GGGTAATCCGTTCACGTGCTCCTGCGACATCATGTGGCTCAAGACTCTCCAGGAGACTAAATCCAGCCCCGACACTCAGGATTTGTACTGCCTCAATGAG

AGCAGCAAGAACATGCCCCTGGCGAACCTGCAGATACCCAATTGTG GTCTGCCATCTGCACGTCTGGCTGCTCCTAACCTCACCGTGGAGGAAGGAAAG

TCTGTGACCCTTTCCTGCAGTGTGGGGGGTGACCCACTCCCCACCTTGTACTGGGACGTTGGGAATTTGGTTTCCAAGCACATG AATGAAACAAGCCAC

ACACAGGGCTCCTTAAGGATAACGAACATTTCATCTGATGACAGTGGAAAGCAAATCTCTTGTGTGGCAGAAAACCTTGTAGGAGAAGATCAAGATTCTG

TGAACCTCACTGTGCATT TTGCGCCAACTATCACGTTTCTCGAGTCTCCAACCTCAGATCACCACTGGTGCATTCCATTCACTGTGAGAGGCAACCCCA

AGCCTGCGCTTCAGTGGTTCTACAATGGGGCCATACTGAATGAGTCCAAGTACATCTGTACTAAGATCCACGTCACCAATCACACGGAGTACCATGGCTG

CCTCCAGCTGGATAACCCCACTCATATGAATAACGGAGACTACACCCTGATGGCCAAGAACGAGTATGGGAAGGATGAGAGACAGATCTCCGCTCACTTC

ATGGGCCGGCCTGGAGTCGACTACG AGACAAACCCAAATTACCCTGAAGTCCTCTATGAA GACTGGACCACGCCAACTGACATTGGGGATACTACGAA

CAAAAGTAATGAAATCCCCTCCACGGATGTTGCTGACCAAAGCAATCGGGAGCATCTCTCG GTCTATGCCGTGGTGGTGATTGCATCTGTGGTGGGATT

CTGCCTGCTGGTGATGTTGCTCCTGCTCAAGTTGGCGAGACATTCCAAGTTTGGCATGAAAG - UNI13941 - - UNI33589 - GCCCAGCTTCG

GTCATCAGCAACGACGATGACTCTGCCAGCCCCCTCCACCACATCTCCAATGGGAGTAACACTCCATCTTCTTCGGAGGGCGGTCCCGACGCTGTCATTA

TTGGAATGACCAAGATTCCTGTTATTGAAAACCCCCAGTACTTTGGCATCACCAACAGTCAGCTCAAGCCAGACACAT TTGTTCAGCATATCAAGAGAC

ACAACATCGTTCTGAAGAGGGAACTTGGGGAAGGAGCCTTCGGGAAAGTTTTCCTTGCCGAGTGCTACAACCTCTGCCCAGAGCAGGATAAGATCCTGGT

GGCTGTGAAG ACGCTGAAGGACGCCAGCGACAATGCACGCAAGGACTTTCATCGGGAAGCTGAGCTGCTGACCAACCTCCAGCACGAGCACATTGTCAA

GTTCTACGGTGTCTGTGTGGAGGGCGACCCACTCATCATGGTCTTTGAGTACATGAAGCACGGGGACCTCAACAAGTTCCTTAG GGCACACGGGCCCGA

CGCAGTGCTGATGGCAGAGGGTAACCCGCCCACAGAGCTGACGCAGTCGCAGATGCTGCACATCGCTCAGCAAATCGCAGCAGGTATGGTCTACCTGGCG

TCCCAACACTTTGTGCACCGTGACCTGGCCACCCGGAACTGCCTGGTGGGAGAGAACCTGCTGGTGAAAATTGGGGACTTTGGGATGTCCCGAGATGTGT

ACAGCACCGACTACTATCGG - UNI33671 - GTCGGTGGCCACACAATGTTGCCCATCCGATGGATGCCTCCAGAGAGCATCATGTACAGGAAATTC

ACCACCGAGAGCGACGTCTGGAGCCTGGGCGTTGTGTTGTGGGAGATCTTCACCTACGGCAAGCAGCCCTGGTATCAGCTATCGAACAATGAG GTGATA

GAGTGCATCACCCAGGGAAGAGTCCTTCAGCGGCCTCGAACGTGTCCCCAGGAGGTGTATGAGCTCATGCTTGGATGCTGGCAGCGGGAACCACACACCC

GGAAGAACATCAAGAGCATCCACACCCTCCTTCAGAACTTGGCCAAGGCATCTCCCGTCTACCTGGATATCCTAGGCTAGGGTCCTCCTTCTGCCCAGAC

CGTCCTTCCCAAGGCCCTCCTCAGACTGGCCTACACGACGAACCTCTTGACTGCCGCTGACGTCATGACCTTGCTGTCCTTCGCTCTGACAGTGTTGACA

GGACCAGGAGCGGCTCTTTGGGGGAGGCAGTGTGTGCTTCTCCATCCACAGACAGTATTAACTCGCTTCTGGCATTGTCTCTTTCTCTCCCTTGGGTTTG

TTTCTTTCTTTTGCCCCTTCCCCTTTTATCATTATTTATTCATTTATTTATTTTCTGGTCTTCACCGCTTCACGGCCCTCAGTCTCTCCTTGACCAATCT

GGCTTCTGCATTCCTATTAACTGTACATAGACAAAGGCCTTAACAAACCTAATTTGTTATATCAGCAGACACTCCAGTTTGCCCACCACAACTAACAATG

CCTTGTTGTATTCCTGCCTTTGACGTGGATGAAAAAAAGGGAAAAAAAAATCAAACATCTGACTTAAGCTGTCACTTCCGATGTACAGACGTGGGGCGTT

TCTATGGATTCACTTCTATTTATTATTTATTAATTTATTTATTTATCACTCTTCTTATTGTTTTCTGGTGGTTTTAACCTATGTGTGAGAAGGAAAAGTT

GTGTACAATCTGGGAAAACTTTATCAGTGGGAAATGAAAACGAGAGCGAGCAAGCGAGCAAGAGAGGGAGAGAGAGAGAGAAGCGTTACCATAAACCACG

GCATGAGCGAGACAGAGACAAGCCATGGGATCAGTCGGGAGTCCGTTGTGCTTAGGAAAACCCAGCAGCCATTAGCTGGGGGAGCATGTTCGGCTCTGTC

CCCCAAGCACCTTTCTGAGGAGGACACAGGATGTTGAACTCTGCTTCACGGGCAGAGCTTCTAATGACAGATACTGGCTTGCACTGGAAAGACAGTTCCC

ACGGGACCTGGACGGACAACACATCCTACATTCAGACATTGTGGTCGGGCACGGTGACAGAGTTGATCCGTTTCTCAAGTGTTATCTACCAAGCTTTTGT

GAAGTTCCATCGAAGGAGGTAGATTCTTGCTCAGATATAATTTCAGGAAAACCCGAGTCCTTGACAAAGACAGGAGACGCTCTCAATTTGGAGGCAAGTT

TCTCTTACCTTGAACTTTTTCAGACAGCAACTCCGCCCAGCCCCCATCTTCCACTCTCACCTGTCTTGTAACTGTGCAAACAAAAGTGTGCATGGTCTTT

GTCAATTGATACCTATGTGCACGTGTGCAGAAACTGTTGTTCCAGCTGGGGTGTCTGATTAGGAGGGCAGATCCATAAAAGGTCTAACCTAGGCAACTTC

GGGAAAGGAGACCAGATCAGTAGCTGGAGGCACTCTCCAGTAGGCGGTGAGGGGTTTACTGAGTAGGCATGCTGAAGCCCGGATATTCACCCATCTCAAA

CCCCCCGGGCTGCAGGACAGGCACAGGCCATCCCTGAGGAGAAGGGGAGCCCTTTTGGGATACCACCTGAGGTTATGTTCAGTGTGCTCTGGTCAAGTCC

CTTGCTCGGGGCTCTGTTTGGGGAGAGTGGTTTCATTCCAAGGTACTCATTATTAGTATGCTGTTTTGTTAACTATACTCCATTAAAAAGTTAAAAAAAA

AAAGAATTAAGCCTTGACACTGTATGGCTGACAGGAGGCTGTGCCCAGACTGAGCCTGGAGATTTGCGCCCGCACATGGTCATTGGTTTTCCGAAAAGAG

AGGGTAAATTTATATAGAAATTTACAGGTATTTGGGTAGTCATTTAGACCGAGGGAGACCAGTGTTTCCATTTCTCTGCGCCCCCTCTGTGAGGGGAAGT

TCGATACACTTGACACCTTTATAAACGGAGCCAGATAGGAAGGGAGTGACTTAATTCACCTTAGAACATTTCATTTGGTGTTTATTTCTGAAGGTGCAAG

AGCTCTGTGTAGGTTTCATTTGTGCCCGAGCATTTCTGGAGCACTGTGTTTTCTAGCAGAAACTCCGAGAGCCAGTTCTCACAATGAAACTTTAAAACCT

GTGTAAATTGACAGAGAGCAGAAGGCGATCCAAGAGGCCCACTCAAGTGAGTGGTGGCACGAGGCACATGCGGTGGCCCTTTCTGTTGTGCTGGCCCATG

AGAGATGGGAGCTATTTTGTCCTCTTCGTCCATTAAAACAAACCCCTCCAGAATACCTATAGTAATATAATGAAAGCCATATCTCTGTGATCTATACCGT

CAGGTATAGATCATTAAAGGACCCATGGTACTGTCAGGCACTGTGGAACCGTGAGGCAGCGGAAAGGCAAGGGCACATTTGTACATGTTCCTCTAGCTTC

CGCCAGCCGTGACCTATGAACTCACATAGGCCGGTTGCTCCTAGTCTGACGGGCTGCCCTGGGAGGAAAAGCTGCAAGATGCTCAGCAGAGAGCAAAGGA

GAGGATAGTCTTGGAAAAGGCCAAGGTTGGGGATGCCATACAGGATTACACCAAAGGGCTGTACTGAGAATGTGGGAGCATTCCATTCCAGGTTTGTATT

TTCCTCAGCAAGAAAAAAGAGCAGATAGAAGGGCAGAGGAGGATAGAGAGGAAGAGAAAGGAGAGGGAGAAGAGAGCAGAGAAGAGAGAGAGAGAGAGAG

AGAGAGAGAATCTTTATACTTTTTGGCAAGTCCTCGAAGGTCTCAAAATGAAAGTGTCTATGCAAGTGCAAATTTTTACAGTTATTTATACTAATTATTA

TTATTGTTATTAATTATTATTATTACTAGTCTGTTGTCTCAAGAATATGTGCAGATTTCAGAGCATTAAAGAGTATTTGGTTTCTTTTAAAGTAGTTGGG

TGAGCCAAGGACACCTTAAAATAATTGTCACTGTTCATCTGCTATCGCCTTTCTCATGGTATTTTAAGTTTTAGAAAAGAAACATTCTTGTTCTAAAACA

TATCCCTCTCCATAGATGACAAAAAAAAATGGTGTTAGCAAACCGAAACCTCCCCCGATTCCTGTCTGACATCCGATCCATTTCTCAACTGCTTGATGAT

TTCCGAGCGCTTTTTGCATATGTTGTCAAAATATTCATATTATTTTGGTGAGGGAATGGAGACTCAGAAACTCAGAGGACAAACATAAGCTTCACCGAAG

TCTGTCTGCCAGATACAAACTAACATACAAACAAGACAGCCGGGAAGGAAATGTGCTGGTAGCGTGTCTGTGGAGCAGGGTGGGGGTTAGAACAGAAGGA

GACCTGGGCAGTGCACGCAGAAGAGATGTTACATCATGTGCTTCTGCTCCTGGCTTCTGCTGACTCCCAACTTTGCGCTCAGCCTCATTTAGAAAACGCT

TCAAACACTGCTCTTCAGGGTTCTGTCAGAACTCACACACACGTGCTCACACCAGCCCCGCTTGTGACGTTTTTATGTACTTCTATATAAATATATACAT

AATATATGTTATAAACACTTGATTTATACATATACAAATGCACACATGTAGTGTGTTTGTGTGTTTATGTATAAACATATAGGCTCATGGTAATAGAATA

ATTATAAGTAGGGTGCAATATGAATAATTTGCTTAATATTTGCTAAGTAACCAAAACTTTCCAACGTCATGTGGCAGTTCATATTTCCACTCTCAGTGTG

GGTAAGGATGGGCTACACCACACTTTCAGCTCTGTGCAGCCCTTGGATGGAAGATGTGTTGAAAAAAAAATCACATCTTCCCTGAAACAACTGACTGAAA

GCCATCCTCTACATTGAATCTGTTCTCTGGCTCTTTGCAAAGGAGAAATGCAGACAAATGGTCTCCTTGTGTCCCAGTCCTGGGAAGGAGAAGTGGGTTT

TCTCTTCTTGCACATTTGGGCCGTGCTCACCTTTCCTGGCTCTATGCCCTTTACACTGGGCTCAGAGATGAAGCAGTCTAGACCCAAGCTGCAGGGCTGT

AGGGAGGCAAATGTCTTCGAGGCTGATAGCAAAGCATCCAAAAATCTATAGCAAGATGCGCAGCTTGAAGTCACTCCTCATCCACACGGCAAGCAAGAGC

CAGGGCATGCAGTGCTGTCCATCTCTAGGACTGGGCAGTGGGGTCCCCGGTCAAGGGCAGTCTTTCCCTAAGCCTCTCCTTTTGCAAATGGCACTGCCAG

CAGTACCTGGCATTAAGTCACGAAAAATTTCTAAAATGGCAGCACAGACCCGTGTGCCCTCATTGCTCTGCCCCCACATGCCTCATCATTAGAGGGCTCC

AGTTTTCAAACTTGACTTTCCATTTGGCCCTGTATCGTGGTTAAAGGAAATCTCAACAGAGGGATGGCCAATTGACCTAAATCCCCAGATGTCCAAGTTT

GCAGTGAAAGCCAGTTCTTCCCAAATGTATAACTGGAATGTAGGGACTCAGGTTGTGATACTTCATACAGGAATCTCAGATGTTATTGTAAAGAACTGGG

TTGGGAGGGATTCATCACTAAGCCAACAATAATGCAGGAGGGCGTGGCTGATCGTTAAGCCAATAGTAGTGCAGGAGGGCGTGGCTGCTGTGAGGGCTGG

AATCCATCTCTGCTGCTAAAGTTCAGGGTTCTCAACTCTTTTCAGCTGTTGCAGCCCTTCACTTCTTTCCCTTCGGCGTTATTTATTTGTGTATTTATTT

ATTTATTTATTTATTTATCTATCTATCTATCAACTTTTGGTCCATTCATCACCAACATAAAGCAAAAACAATTTTTTACATATATGTAAATGTGTTGCAA

GTGAAACACTGTGAATCTCACAACCACCTCCTAGCAACTATGCTGCCATCTTGACGTGCGTCTCAGGAGTCGAGACGGGAAAAGACGAGGACGTCATTTT

GCAGCCTACGCATTCTGGGCCAGGTCCGTGTTCGTTTTATTTCTTTAGTCTGTGAGTTAAGAAAACAATCCGAGTGGAGGGTGACGGATGTTCGGCAAGT

TCGGTGAAGCAGCACGAGCTCTTTGCAGCTATAGGTTCGAGCAAGAAGAAAAACCATGGGAGATGGAGAAGGGAAATTTGATGGAGGGGTGGGGTGGGGT

GGGGGCTCTGTCTTACAGCTCGTGTAGCTTACTGTTGCTTAAAAATGTATACAACAGCTGGAAATGTTTTCAACACAAGGTATTTGAAATAAATGTGAAT

CTTAAATATGTACTCCCTTAAGGAATGAACATATTATGGTGAAATATTGCTCCCCCGCGTCCCCTACAAATCTGCCTAGAGATGTGGATACCTACATTTG

CTTAAGCATCAGACCAGTGTTTGTATATACCCGGGCCATACACACTCATCTCGACGTCTCTCTGCGGATGTATTTCCCCTTCACTGGTGACCTGGTATTT

AGAACTCCGTCTTTTCAGTTGGTTTATTTCCCTTTAATGTGATGTCTCTGTGCCGATTATTACCGGTTCTTACTTGTTTTTGCAATCCGTTTTGAGGTCC

AGTGTTTTACTGAGACTCATTGCATCTTGGCTGATTTCAAAGTGACACCCGAATACAGTGTTTAAAAAAAAAGTTTGTTTGTAAATCATGTGACCAGCTT

CTCTCACCCTGACATGGAATGTCTCTTGTACTACAGTGTATTTAATAATAAAAGAAAAAAATGATGTCTTACAATAAATAACATCTTCCACAAGAGG
Translation
 MSPWLKWHGPAMARLWGLCLLVLGFWRASLACPTSCKCSSARIWCTEPSPGIVAFPRLEPNSVDPENITEI ILIANQKRLEIINEDDVEAYVGLRNL 

LTIVDSGLKFVAYKAFLKNSNLRHI INFTRNKLTSLSRRHFRHLDLSDL LILTGNPFTCSCDIMWLKTLQETKSSPDTQDLYCLNESSKNMPLANLQI

PNCG GLPSARLAAPNLTVEEGKSVTLSCSVGGDPLPTLYWDVGNLVSKHM NETSHTQGSLRITNISSDDSGKQISCVAENLVGEDQDSVNLTVHF FA

PTITFLESPTSDHHWCIPFTVRGNPKPALQWFYNGAILNESKYICTKIHVTNHTEYHGCLQLDNPTHMNNGDYTLMAKNEYGKDERQISAHFMGRPGVDY

E ETNPNYPEVLYE DWTTPTDIGDTTNKSNEIPSTDVADQSNREHLS VYAVVVIASVVGFCLLVMLLLLKLARHSKFGMKG - UNI13941 - - U

NI33589 - GPASVISNDDDSASPLHHISNGSNTPSSSEGGPDAVIIGMTKIPVIENPQYFGITNSQLKPDTF FVQHIKRHNIVLKRELGEGAFGKVF

LAECYNLCPEQDKILVAVK TLKDASDNARKDFHREAELLTNLQHEHIVKFYGVCVEGDPLIMVFEYMKHGDLNKFLR RAHGPDAVLMAEGNPPTELTQ

SQMLHIAQQIAAGMVYLASQHFVHRDLATRNCLVGENLLVKIGDFGMSRDVYSTDYYR - UNI33671 - VGGHTMLPIRWMPPESIMYRKFTTESDV

WSLGVVLWEIFTYGKQPWYQLSNNE VIECITQGRVLQRPRTCPQEVYELMLGCWQREPHTRKNIKSIHTLLQNLAKASPVYLDILG

For any suggestions or comments, please send an email to unitrap@crg.es