Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000055401 (Fbxo6)
Chromosomal location
Chr 4: 147519825 - 147526168 (-)
Description
F-box protein 6 Gene [Source:MGI (curated);Acc:Fbxo6-003]
RefSeq_dna
NM_015797 
RefSeq_peptide
NP_056612.1 
UniGene
Mm.27445 
MGI
MGI:1354743 
Uniprot/SWISSPROT
Q9QZN4 
Uniprot/SPTREMBL
A2A7G9 A2A7H0 A2A7H1 A2A7H2 A2A7H3 B2KFL0 B2KFL1 B2KFL2 B2KFL3 Q3UCB0 
Human Ortholog
ENSG00000116663 (FBXO6)
Omim not available
UniTrap UNI15795
Vector Insertion
Chr 4: 147523776 - 147525722
Public Clones IST14230G1 (tigm) IST10793H4 (tigm) IST14696G10 (tigm)
Private Clones OST472925 (lexicon) OST453303 (lexicon) OST435728 (lexicon) OST434430 (lexicon)
OST385204 (lexicon) OST383147 (lexicon) OST371032 (lexicon) OST369089 (lexicon)
OST341216 (lexicon) OST308487 (lexicon) OST305402 (lexicon) OST305356 (lexicon)
OST301995 (lexicon) OST292918 (lexicon) OST287214 (lexicon) OST269223 (lexicon)
OST266059 (lexicon) OST264832 (lexicon) OST262233 (lexicon) OST249284 (lexicon)
OST232387 (lexicon) OST232348 (lexicon) OST221973 (lexicon) OST211407 (lexicon)
OST208510 (lexicon) OST190087 (lexicon) OST164942 (lexicon) OST145475 (lexicon)
OST132247 (lexicon) OST109816 (lexicon) OST109760 (lexicon) OST86332 (lexicon)
OST82871 (lexicon) OST35758 (lexicon) OST32846 (lexicon) OST32593 (lexicon)
OST32589 (lexicon) OST32586 (lexicon) OST32575 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI22438
Vector Insertion
Chr 4: 147521531 - 147523487
Public Clones not available
Private Clones OST297014 (lexicon) OST248976 (lexicon) OST208939 (lexicon) OST184496 (lexicon)
OST72864 (lexicon)
Severity of mutation (?) Insertion after 29% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000030858
Sequence
GGGTCGCCGAGGTCCAGGCCCAAGGCCCTGGAGAGCTGAGGCCCCCCTTCCTCCGGTGCCCAGGTCGCGGCCGCTGGGCAGCGGGGACCGCGAGTGGCCG

GCGGGAGGGTGGGGCCGGGCGCAGGTCACGCGCTCGTGGGGAGACTTGGGAGGGGTGCGGCAGGTGCTCTCGAGTCCGGCGCCGGGACGCGGGGACGCCG

GGCCTGCTGTAGGCACGCGAGGGTCCCGGACGGTGGCGACACCGGCTTCTCCTTGGGACGCCGGGCTTCAGGCGCTAGG - UNI15795 - GTCTGGG

AACGTAATTCTCTGTTGCCACCATGGTCCACATCAACGAGCTGCCAGAGAACATTCTCCTGGAGCTGTTCATCCATATCCCGGCCCCACAGCTGCTGCGC

AACTGCCGCCTGGTCTGCCGCCTCTGGCGAGACCTCATCGATGTGGTGTCCCTATGGAAGCGCAAGAGTCTTCGAGAGGGCTTCTTCACCAAAGACCGGT

GCGAGCCCGTGGAAGACTGGAAGGTCTTCTATATCCTGTGCAGCCTGCAGAGGAACCTCCTTCGGAACCCGTGTGCTGAAG - UNI22438 - AGAAC

CTGAGCTCATGGCGGATAGACTCCAACGGAGGGGATCGCTGGAAGGTGGAGACGCTCCCTGGGAGCTGTGGCACAAGCTTTCCTGACAACAAGGTCAAGA

AGTATTTTGTCACCTCTTTTGA GATGTGCCTCAAATCCCAGATGGTGGACCTCAAAGCTGAGGGCTACTGCGAGGAGCTGATGGACACCTTTCGGCCTG

ACATTGTGGTTAAGGACTG GGTTGCCCCCAGAGCAGACTGTGGCTGCACCTATCAACTCCGGGTACAGCTGGCCTCTGCGGACTACATTGTCTTGGCCT

CTTTTGAGCCTCCACCTGTGACATTCCAACAGTGGAATGATGCCAAATGGCAAGAG ATTTCCCACACCTTCTCTGATTACCCTCCAGGTGTCCGTCACA

TCCTTTTTCAACACGGGGGCCAGGACACTCAGTTCTGGAAAGGCTGGTACGGCCCCCGTGTCACCAACAGCAGCATCATTATCAGCCACAGGACAGCCAA

GAACCCTCCCCCTGCCAGAACTCTACCGGAAGAAACTGTAGTAATCGGAAGGAGACGGCGAGCTTCGGACTCCAACACTCATGAGGGTTTCTTCTGGCAA

GGGCTATGGCAAAGGCTAAGGCGTTAGTGGGCAGTCAGGCTCCCAGTCCCATGAGCACTTGCCCTATACAACCTTGGGCAAGCCCATCAACTCAGTAGTG

ATAGTTGGCACCCACAGCTCTGACATTTTGTTGTAATAAATGTTTTCAGTAACCC
Translation
 - UNI15795 - MVHINELPENILLELFIHIPAPQLLRNCRLVCRLWRDLIDVVSLWKRKSLREGFFTKDRCEPVEDWKVFYILCSLQRNLLRNPCAE

E - UNI22438 - ENLSSWRIDSNGGDRWKVETLPGSCGTSFPDNKVKKYFVTSFE EMCLKSQMVDLKAEGYCEELMDTFRPDIVVKDW WVAPRAD

CGCTYQLRVQLASADYIVLASFEPPPVTFQQWNDAKWQE ISHTFSDYPPGVRHILFQHGGQDTQFWKGWYGPRVTNSSIIISHRTAKNPPPARTLPEET

VVIGRRRRASDSNTHEGFFWQGLWQRLRR
Transcript ENSMUST00000105706
Sequence
GAGGTGACAGAGGACCGGGTCGCCGAGGTCCAGGCCCAAGGCCCTGGAGAGCTGAGGCCCCCCTTCCTCCGGTGCCCAGGTCGCGGCCGCTGGGCAGCGG

GGACCGCGAGTGGCCGGCGGGAGGGTGGGGCCGGGCGCAGGTCACGCGCTCGTGGGGAGACTTGGGAGGGGTGCGGCAGGTGCTCTCGAGTCCGGCGCCG

GGACGCGGGGACGCCGGGCCTGCTGTAGGCACGCGAGGGTCCCGGACGGTGGCGACACCGGCTTCTCCTTGGGACGCCGGGCTTCAGGCGCTAGGGTAGG

ACGTCCGCTCGTGACCCAGCCGCAGCCTGGTGTGGATTTTACCCCTAAGGCACACCAGGGGCACTGTAGTCTCCCTGGCAAGGTGGCTTGTTTTGGGGGG

GGAGAGTGACACTGGAGTGGAATGCCATCAGGACCACGGCAGGGGGAGACCCCCCACTCGGGACACAGTGACTCACCCGTGTAGGCAGCTTTTAGGAGTT

GCCGACATCTTTTAATGCGCATAGTTTAAGATTGTTGTTGGTTGTCCTTTCCTTAGGATGGAGCCCAGGGCCTCCCAAGTGTTAGATAAGCATGCTACCA

CCCGGCAGCACCTCCCCCACCCCCACCCCCACCCCACCCCCGTGAGGGGGAGACATTTCTGCTCCTTCTGCCTGGAAGTTCACAGTCCTTCTAAATGAGT

CATTGCCAGCCTTATTTACTTTTACTTTGTATTTTGAGACGAGCAAAATTGATTAGGCTGGGACAAAAAGTTCAAACTTTCCACCGAGTATCTGGGACTG

TGAGGGCGTGCCTCCACTCAG - UNI15795 - GTCTGGGAACGTAATTCTCTGTTGCCACCATGGTCCACATCAACGAGCTGCCAGAGAACATTCTC

CTGGAGCTGTTCATCCATATCCCGGCCCCACAGCTGCTGCGCAACTGCCGCCTGGTCTGCCGCCTCTGGCGAGACCTCATCGATGTGGTGTCCCTATGGA

AGCGCAAGAGTCTTCGAGAGGGCTTCTTCACCAAAGACCGGTGCGAGCCCGTGGAAGACTGGAAGGTCTTCTATATCCTGTGCAGCCTGCAGAGGAACCT

CCTTCGGAACCCGTGTGCTGAAG - UNI22438 - AGAACCTGAGCTCATGGCGGATAGACTCCAACGGAGGGGATCGCTGGAAGGTGGAGACGCTCC

CTGGGAGCTGTGGCACAAGCTTTCCTGACAACAAGGTCAAGAAGTATTTTGTCACCTCTTTTGA GATGTGCCTCAAATCCCAGATGGTGGACCTCAAAG

CTGAGGGCTACTGCGAGGAGCTGATGGACACCTTTCGGCCTGACATTGTGGTTAAGGACTG GGTTGCCCCCAGAGCAGACTGTGGCTGCACCTATCAAC

TCCGGGTACAGCTGGCCTCTGCGGACTACATTGTCTTGGCCTCTTTTGAGCCTCCACCTGTGACATTCCAACAGTGGAATGATGCCAAATGGCAAGAG A

TTTCCCACACCTTCTCTGATTACCCTCCAGGTGTCCGTCACATCCTTTTTCAACACGGGGGCCAGGACACTCAGTTCTGGAAAGGCTGGTACGGCCCCCG

TGTCACCAACAGCAGCATCATTATCAGCCACAGGACAGCCAAGAACCCTCCCCCTGCCAGAACTCTACCGGAAGAAACTGTAGTAATCGGAAGGAGACGG

CGAGCTTCGGACTCCAACACTCATGAGGGTTTCTTCTGGCAAGGGCTATGGCAAAGGCTAAGGCGTTAGTGGGCAGTCAGGCTCCCAGTCCCATGAGCAC

TTGCCCTATACAACCTTGGGCAAGCCCATCAACTCAGTAGTGATAGTTGGCACCCACAGCTCTGACATTTTGTTGTAATAAATGTTTTCAGTAACCCAGC

CTGGTTTGAGGGCTTACAGGTGGGTTGCTGGCACTCTGAGAAAGAGCCCCTTCTCAGGGCAGCTTCGAT
Translation
 - UNI15795 - MVHINELPENILLELFIHIPAPQLLRNCRLVCRLWRDLIDVVSLWKRKSLREGFFTKDRCEPVEDWKVFYILCSLQRNLLRNPCAE

E - UNI22438 - ENLSSWRIDSNGGDRWKVETLPGSCGTSFPDNKVKKYFVTSFE EMCLKSQMVDLKAEGYCEELMDTFRPDIVVKDW WVAPRAD

CGCTYQLRVQLASADYIVLASFEPPPVTFQQWNDAKWQE ISHTFSDYPPGVRHILFQHGGQDTQFWKGWYGPRVTNSSIIISHRTAKNPPPARTLPEET

VVIGRRRRASDSNTHEGFFWQGLWQRLRR
Transcript ENSMUST00000056965
Sequence
GGGGGAGACGGAAGCCGGGGAAGCCCGGCCAGTGGAGCAGCAGCTTGGTGAGGGGGGGGGGGGATCCTAGAGCTCCGAGCTCACCATCTTCGCACCGACG

CGGAAGGCCCGCTGGTCG - UNI15795 - GTCTGGGAACGTAATTCTCTGTTGCCACCATGGTCCACATCAACGAGCTGCCAGAGAACATTCTCCTG

GAGCTGTTCATCCATATCCCGGCCCCACAGCTGCTGCGCAACTGCCGCCTGGTCTGCCGCCTCTGGCGAGACCTCATCGATGTGGTGTCCCTATGGAAGC

GCAAGAGTCTTCGAGAGGGCTTCTTCACCAAAGACCGGTGCGAGCCCGTGGAAGACTGGAAGGTCTTCTATATCCTGTGCAGCCTGCAGAGGAACCTCCT

TCGGAACCCGTGTGCTGAAG - UNI22438 - AGAACCTGAGCTCATGGCGGATAGACTCCAACGGAGGGGATCGCTGGAAGGTGGAGACGCTCCCTG

GGAGCTGTGGCACAAGCTTTCCTGACAACAAGGTCAAGAAGTATTTTGTCACCTCTTTTGA GATGTGCCTCAAATCCCAGATGGTGGACCTCAAAGCTG

AGGGCTACTGCGAGGAGCTGATGGACACCTTTCGGCCTGACATTGTGGTTAAGGACTG GGTTGCCCCCAGAGCAGACTGTGGCTGCACCTATCAACTCC

GGGTACAGCTGGCCTCTGCGGACTACATTGTCTTGGCCTCTTTTGAGCCTCCACCTGTGACATTCCAACAGTGGAATGATGCCAAATGGCAAGAG ATTT

CCCACACCTTCTCTGATTACCCTCCAGGTGTCCGTCACATCCTTTTTCAACACGGGGGCCAGGACACTCAGTTCTGGAAAGGCTGGTACGGCCCCCGTGT

CACCAACAGCAGCATCATTATCAGCCACAGGACAGCCAAGAACCCTCCCCCTGCCAGAACTCTACCGGAAGAAACTGTAGTAATCGGAAGGAGACGGCGA

GCTTCGGACTCCAACACTCATGAGGGTTTCTTCTGGCAAGGGCTATGGCAAAGGCTAAGGCGTTAGTGGGCAGTCAGGCTCCCAGTCCCATGAGCACTTG

CCCTATACAACCTTGGGCAAGCCCATCAACTCAGTAGTGATAGTTGGCACCCACAGCTCTGACATTTTGTTGTAATAAATGTTTTCAGTAACCC
Translation
 - UNI15795 - MVHINELPENILLELFIHIPAPQLLRNCRLVCRLWRDLIDVVSLWKRKSLREGFFTKDRCEPVEDWKVFYILCSLQRNLLRNPCAE

E - UNI22438 - ENLSSWRIDSNGGDRWKVETLPGSCGTSFPDNKVKKYFVTSFE EMCLKSQMVDLKAEGYCEELMDTFRPDIVVKDW WVAPRAD

CGCTYQLRVQLASADYIVLASFEPPPVTFQQWNDAKWQE ISHTFSDYPPGVRHILFQHGGQDTQFWKGWYGPRVTNSSIIISHRTAKNPPPARTLPEET

VVIGRRRRASDSNTHEGFFWQGLWQRLRR

For any suggestions or comments, please send an email to unitrap@crg.es