Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000055421 (Pcdh9)
Chromosomal location
Chr 14: 93414731 - 94287951 (-)
Description
protocadherin 9 Gene [Source:MGI Symbol;Acc:MGI:1306801]
RefSeq_dna
NM_001081377 
RefSeq_peptide
NP_001074846.1 
MGI
MGI:1306801 
Uniprot/SPTREMBL
Q2TJI1 Q8C421 B2RY69 Q2TJI0 Q2TJI2 Q8BY10 
Human Ortholog
ENSG00000184226 (PCDH9)
Omim not available
UniTrap UNI36191
Vector Insertion
Chr 14: 93414730 - 93726100
Public Clones IST10322H8 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 66% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000074766
Sequence
CGCTGTCGCCATGCGTCCAGGTTCAAGGCCGCTCAGAGGAGCAAACAAGGGGCTGAATGGATGTCCCCAAACCAGGAGAATAAACAAAATAAGAAAAAGA

AACGGAAGAAAAGAAAGTCGCCCAAGAGTTCTCTTTTGAACTTTGTTACTATTGAAGAGTCCAAACCCGATGATGCCGTTCATGAACCCATCAATGGGAC

CATAAGCCTGCCTGCCGAGCTGGAGGAACAGGGTATAGGAAGATTTGACTGGGGCCCAGCCCCTCCAACCACCTTCAAGCCTAACAGCCCTGACCTGGCC

AAGCACTACAAGTCGGCCTCTCCTCAGCCCGCTTTTCATCTCAAACCTGACACTCCAGTTTCTGTGAAAAAGCACCACGTCATTCAAGAGCTCCCGTTGG

ACAACACCTTTGTTGGGGGCTGCGACACCCTTTCCAAACGCTCCTCCACTAGTTCAGATCACTTCAGTGCCTCAGAGTGCAGCTCCCAAGGAGGCTTCAA

GACAAAGGGCCCCTTACACACCAGACAG - UNI36191 - TCTCAGCGCCGTGTTACCTTTCACCTTCCGGATGGCTCCCAGGAAAGCTGCAGTGACA

GTGGTCTGGGAGACCACGAGCCGGTGGGTAGTGGAACCCTGATCTCACACCCTCTTCCTCTGGTTCAGCCACAGGACGAATTCTACGACCAGGCCTCTCC

GGACAAGAGGACCGAAGCAGATGGCAACTCGGATCCCAATTCTG - UNI36191 - ATGGACCTCTGGGTCCCCGAGGTTTAGCTGAAGCTACAGAGA

TGTGCACTCAAGAGTGTCTGGTTTTGGGTCACTCTGATAATTGCTGGATGCCTCCTGGCTTGGGTCCATACCAACACCCTAAATCTCCTCTGTCAACCTT

TGCACCCCAGAAAGAATGGATCAAGAAAGACAAGCTTGTGAATGGGCACACCCTGACAAGAGCGTGGAAAGAAGACACCAACAGGAACCAATTCAATGAC

CGTAAGCAGTATGGCTCCAATGAAGGCCATTTCAACAATGGCGGCCACATGGCGGACATTCCTCTGGCAAATCTGAAGTCCTATAAGCAAGCAGGAGGCA

CGATTGAGAGTCCTAAGGAGCACCAACTTTAA
Translation
RCRHASRFKAAQRSKQGAEWMSPNQENKQNKKKKRKKRKSPKSSLLNFVTIEESKPDDAVHEPINGTISLPAELEEQGIGRFDWGPAPPTTFKPNSPDLA

KHYKSASPQPAFHLKPDTPVSVKKHHVIQELPLDNTFVGGCDTLSKRSSTSSDHFSASECSSQGGFKTKGPLHTRQ - UNI36191 - SQRRVTFHLP

DGSQESCSDSGLGDHEPVGSGTLISHPLPLVQPQDEFYDQASPDKRTEADGNSDPNSD - UNI36191 - DGPLGPRGLAEATEMCTQECLVLGHSDN

CWMPPGLGPYQHPKSPLSTFAPQKEWIKKDKLVNGHTLTRAWKEDTNRNQFNDRKQYGSNEGHFNNGGHMADIPLANLKSYKQAGGTIESPKEHQL
Transcript ENSMUST00000068992
Sequence
ATGGACCTGAGGGATTTTTACCTGTTGGCTGCTCTGATTGCCTGTTTAAGGCTGGATTCCGCAATAGCTCAAGAACTTATTTACACTATTAGAGAGGAAT

TGCCTGAAAATGTGCCCATAGGAAATATACCAAAGGATCTGAATATTTCTCACATCAATGCTGCCACGGGGACCAGTGCCAGCCTTGTCTACAGACTGGT

TTCAAAAGCTGGGGATGCCCCTCTGGTGAAAGTATCGAGTAGCACTGGGGAGATTTTCACAACCTCCAACAGAATAGACAGAGAGAAACTCTGTGCTGGG

GCTTCATACGCTGAGGAGAACGAGTGCTTCTTTGAACTTGAAGTAGTGATCCTCCCCAATGACTTTTTCAGGCTGATCAAAATCAAGATCATTGTCAAGG

ATACCAATGATAATGCCCCCATGTTTCCGTCTCCTGTCATCAATATTTCCATCCCAGAGAACACTTTGATCAACAGCCGCTTTCCAATCCCATCAGCCAC

AGACCCTGACACGGGCTTCAATGGGGTACAGCATTATGAATTACTAAATGGACAGAGTGTTTTTGGACTGGATATCGTGGAAACTCCGGAGGGAGAAAAG

TGGCCGCAATTGATTGTTCAGCAGAACTTGGATAGAGAACAAAAAGATACCTATGTGATGAAAATCAAAGTGGAGGATGGGGGCACGCCACAGAAATCGA

GCACAGCTATTCTCCAGGTCACAGTAAGTGATGTCAATGACAACAGGCCAGTGTTTAAAGAGGGTCAAGTAGAAGTGCATATTCCAGAGAATGCTCCTGT

GGGGACCTCTGTCATTCAGCTCCATGCCACTGATGCAGACATAGGCAGTAATGCTGAAATCCGGTATATTTTTGGTGCCCAGGTCGCCCCTGCAACCAAA

AGACTCTTTGCTTTAAATAATACAACTGGGCTGATAACAGTTCAGAGGTCTTTAGATAGGGAAGAGACAGCCATTCACAAAGTGACAGTGCTGGCTAGTG

ACGGCAGCTCCACTCCTGCCAGAGCCACCGTGACCATCAATGTCACCGATGTAAATGATAACCCTCCAAACATAGACCTCAGGTACATTATAAGTCCCAT

CAATGGCACAGTGTATCTCTCTGAGAAAGACCCTGTCAATACAAAGATTGCCCTCATTACAGTTTCAGATAAGGACACAGATGTGAATGGCAAAGTGATC

TGTTTTATTGAAAGAGAGGTCCCATTTCATTTGAAGGCAGTGTATGACAACCAGTATCTGCTAGAGACCTCTTCTCTGCTGGACTATGAGGGCACCAAAG

AATTCAGCTTTAAAATCGTTGCCTCTGATTCGGGGAAGCCCAGTTTGAATCAGACTGCCCTGGTAAGGGTTAAGCTCGAGGATGAAAATGACAACCCACC

AATTTTCAACCAGCCTGTAATTGAGCTGTCAGTTTCTGAAAACAACCGACGTGGGTTATACTTAACAACTATTAGTGCTACAGATGAAGACAGTGGAAAA

AATGCAGACATTGTTTATCAGCTTGGACCGAATGCCTCCTTCTTTGATCTGGACAGAAAGACAGGAGTTTTGACAGCCTCCAGAGTCTTTAACAGGGAGG

AACAAGAGCGGTTCATTTTTACAGTAACTGCCAGGGACAATGGGACCCCTCCCCTCCAGAGCCAAGCAGCAGTGATAGTTACTGTTCTGGATGAGAATGA

CAATAGCCCCAAGTTTACTCATAATCACTTTCAGTTTTTTGTGTCTGAGAATCTGCCAAAGTATAGTACTGTGGGGGTAATCACAGTGACAGACGAAGAC

GCTGGAGAGAATAAAGCTGTGACTCTTTCCATTCTAAATGACAATGAAAATTTTGTGTTGGATCCCTATTCAGGAGTCATAAAGTCCAATGTCTCCTTTG

ATAGAGAGCAGCAGAGTTCCTACACGTTTGACGTCAAAGCCACCGACGGGGGACAGCCACCACGGTCCTCTACTGCAAAAGTAACTATCAATGTCATGGA

TGTCAATGACAATAGTCCAGTTGTCATTTCTCCACCATCCAACACCTCCTTTAAGTTGGTGCCCCTCTCAGCCATTCCTGGTTCTGTGGTTGCTGAAGTG

TTTGCGGTGGATATTGACACCGGAATGAATGCAGAACTCAAGTATACCATAGTGAGCGGGAACAACAAGGGATTATTTCGGATTGATCCAGTAACAGGCA

ATATCACCTTAGAAGAGAAGCCAGCACCTACTGATGTGGGCCTGCACCGTCTTGTGGTCAACATAAGTGACCTGGGGTACCCTAAGGCTTTGCACACTCT

CGTGCTGGTATTTCTTTATGTGAACGACACTGCTGGAAACACCTCATATATATATGACTTGATCCGTAGGACTATGGAGACCCCACTGGACCGGAACATA

GGAGATAGTGGTCAACCTTATCAGAACGAGGACTATCTCACCATCATGATTGCCATCGTTGCTGGGGCCATGGTGGTCATTGTTGTGATCTTTGTCACGG

TGCTGGTGCGCTGTCGCCATGCGTCCAGGTTCAAGGCCGCTCAGAGGAGCAAACAAGGGGCTGAATGGATGTCCCCAAACCAGGAGAATAAACAAAATAA

GAAAAAGAAACGGAAGAAAAGAAAGTCGCCCAAGAGTTCTCTTTTGAACTTTGTTACTATTGAAGAGTCCAAACCCGATGATGCCGTTCATGAACCCATC

AATGGGACCATAAGCCTGCCTGCCGAGCTGGAGGAACAGGGTATAGGAAGATTTGACTGGGGCCCAGCCCCTCCAACCACCTTCAAGCCTAACAGCCCTG

ACCTGGCCAAGCACTACAAGTCGGCCTCTCCTCAGCCCGCTTTTCATCTCAAACCTGACACTCCAGTTTCTGTGAAAAAGCACCACGTCATTCAAGAGCT

CCCGTTGGACAACACCTTTGTTGGGGGCTGCGACACCCTTTCCAAACGCTCCTCCACTAGTTCAGATCACTTCAGTGCCTCAGAGTGCAGCTCCCAAGGA

GGCTTCAAGACAAAGGGCCCCTTACACACCAGACAG TGTAACTCATACAGCAAAAATGACAATATTCCTGTCACACATCAGAAATGTCCCGGCTCTACC

AGTTTCCACATTCGAGAGAATGAAGAAAGTCATTCTGAG - UNI36191 - TCTCAGCGCCGTGTTACCTTTCACCTTCCGGATGGCTCCCAGGAAAG

CTGCAGTGACAGTGGTCTGGGAGACCACGAGCCGGTGGGTAGTGGAACCCTGATCTCACACCCTCTTCCTCTGGTTCAGCCACAGGACGAATTCTACGAC

CAGGCCTCTCCGGACAAGAGGACCGAAGCAGATGGCAACTCGGATCCCAATTCTG - UNI36191 - ATGGACCTCTGGGTCCCCGAGGTTTAGCTGA

AGCTACAGAGATGTGCACTCAAGAGTGTCTGGTTTTGGGTCACTCTGATAATTGCTGGATGCCTCCTGGCTTGGGTCCATACCAACACCCTAAATCTCCT

CTGTCAACCTTTGCACCCCAGAAAGAATGGATCAAGAAAGACAAGCTTGTGAATGGGCACACCCTGACAAGAGCGTGGAAAGAAGACACCAACAGGAACC

AATTCAATGACCGTAAGCAGTATGGCTCCAATGAAGGCCATTTCAACAATGGCGGCCACATGGCGGACATTCCTCTGGCAAATCTGAAGTCCTATAAGCA

AGCAGGAGGCACGATTGAGAGTCCTAAGGAGCACCAACTTTAA
Translation
MDLRDFYLLAALIACLRLDSAIAQELIYTIREELPENVPIGNIPKDLNISHINAATGTSASLVYRLVSKAGDAPLVKVSSSTGEIFTTSNRIDREKLCAG

ASYAEENECFFELEVVILPNDFFRLIKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFPIPSATDPDTGFNGVQHYELLNGQSVFGLDIVETPEGEK

WPQLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRPVFKEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATK

RLFALNNTTGLITVQRSLDREETAIHKVTVLASDGSSTPARATVTINVTDVNDNPPNIDLRYIISPINGTVYLSEKDPVNTKIALITVSDKDTDVNGKVI

CFIEREVPFHLKAVYDNQYLLETSSLLDYEGTKEFSFKIVASDSGKPSLNQTALVRVKLEDENDNPPIFNQPVIELSVSENNRRGLYLTTISATDEDSGK

NADIVYQLGPNASFFDLDRKTGVLTASRVFNREEQERFIFTVTARDNGTPPLQSQAAVIVTVLDENDNSPKFTHNHFQFFVSENLPKYSTVGVITVTDED

AGENKAVTLSILNDNENFVLDPYSGVIKSNVSFDREQQSSYTFDVKATDGGQPPRSSTAKVTINVMDVNDNSPVVISPPSNTSFKLVPLSAIPGSVVAEV

FAVDIDTGMNAELKYTIVSGNNKGLFRIDPVTGNITLEEKPAPTDVGLHRLVVNISDLGYPKALHTLVLVFLYVNDTAGNTSYIYDLIRRTMETPLDRNI

GDSGQPYQNEDYLTIMIAIVAGAMVVIVVIFVTVLVRCRHASRFKAAQRSKQGAEWMSPNQENKQNKKKKRKKRKSPKSSLLNFVTIEESKPDDAVHEPI

NGTISLPAELEEQGIGRFDWGPAPPTTFKPNSPDLAKHYKSASPQPAFHLKPDTPVSVKKHHVIQELPLDNTFVGGCDTLSKRSSTSSDHFSASECSSQG

GFKTKGPLHTRQ CNSYSKNDNIPVTHQKCPGSTSFHIRENEESHSE - UNI36191 - SQRRVTFHLPDGSQESCSDSGLGDHEPVGSGTLISHPLP

LVQPQDEFYDQASPDKRTEADGNSDPNSD - UNI36191 - DGPLGPRGLAEATEMCTQECLVLGHSDNCWMPPGLGPYQHPKSPLSTFAPQKEWIKK

DKLVNGHTLTRAWKEDTNRNQFNDRKQYGSNEGHFNNGGHMADIPLANLKSYKQAGGTIESPKEHQL

For any suggestions or comments, please send an email to unitrap@crg.es