Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000055531 (Cpsf6)
Chromosomal location
Chr 10: 116792994 - 116814029 (-)
Description
cleavage and polyadenylation specific factor 6 Gene [Source:MGI Symbol;Acc:MGI:1913948]
RefSeq_dna
NM_001013391 
RefSeq_peptide
NP_001013409.1 
UniGene
Mm.288682 
MGI
MGI:1913948 
Uniprot/SWISSPROT
Q6NVF9 
Human Ortholog
ENSG00000111605 (CPSF6)
Omim not available
UniTrap UNI24008
Vector Insertion
Chr 10: 116805045 - 116813894
Public Clones IST14424C9 (tigm)
Private Clones OST237853 (lexicon) OST203946 (lexicon) OST194644 (lexicon) OST174950 (lexicon)
Severity of mutation (?) Insertion after 4% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI11951
Vector Insertion
Chr 10: 116803241 - 116804834
Public Clones Q003F04 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 16% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI15756
Vector Insertion
Chr 10: 116797911 - 116799244
Public Clones PST1219-1 (escells) PST1213-1 (escells)
Private Clones not available
Severity of mutation (?) Insertion after 42% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI5182
Vector Insertion
Chr 10: 116797612 - 116797911
Public Clones YTC121 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 72% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI742
Vector Insertion
Chr 10: 116796203 - 116797495
Public Clones CJ0851 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 80% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI4332
Vector Insertion
Chr 10: 116793181 - 116796048
Public Clones AF0800 (sanger) G013F01 (ggtc) P056F06 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 89% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000069168
Sequence
GCCAGATCCGCTGCTGCTGCCTCGGCGGGCCGACCTGCAGGAGGCGGCGGCGGCGGCGGCCGAGGCCGAGGGAAGATGGCGGACGGTGTGGACCACATAG

ACATTTACGCGGATGTGGGTGAAGAGTTCAACCAG - UNI24008 - GAAGCAGAATATGGTGGACATGATCAGATAGATTTGTATGATGATGTCATC

TCTCCATCTGCAAATAATGGCGATGCCCCAGAAGATCGCGACTACATGGATACTCTTCCACCAACTGTTGGTGATGATGTGGGTAAAGGAGCCGCACCAA

ACGTTGTGTACACTTACACTGGGAAGAGAATCGCATTGTATATTGGAAATCTAACATGG - UNI11951 - TGGACAACAGATGAGGACCTAACTGAG

GCCGTTCATTCTTTGGGAGTAAATGATATTTTGGAGATAAAATTCTTTGAAAATCGGGCAAATGGACAATCAAAGGG ATTTGCCCTTGTTGGTGTTGGA

TCTGAAGCATCTTCCAAAAAGTTAATGGATCTTTTGCCTAAAAGAGAACTTCATGGTCAGAGTCCTGTTGTAACTCCATGCAATAAGCAGTTCCTGAGTC

AATTTGAAATGCAATCCAGGAAAA - UNI15756 - CTACACAGTCAGGACAGATGTCTGGGGAAGGGAAAGCCGGTCCTCCAGGAGGCGGTTCACGC

GCAGCGTTTCCTCAAGGTGGTAGAGGACGGGGCCGGTTTCCAGGGGCTGTTCCTGGTGGGGACAGATTTCCTGGGCCAGCAGGACCAGGAGGGCCACCTC

CACCTTTTCCAG - UNI15756 - CTGGACAAACTCCACCACGTCCACCTTTAGGCCCACCTGGCCCACCTGGTCCACCAGGTCCTCCACCTCCTGGT

CAGGTTCTGCCACCTCCTCTAGCAGGACCTCCTAACCGAGGAGACCGCCCTCCACCACCAGTTCTTTTTCCTGGACAACCTTTTGGGCAGCCTCCGCTGG

GTCCACTTCCTCCTGGGCCTCCACCTCCAGTTCCAGGCTACGGCCCCCCTCCAGGTCCACCGCCTCCACAGCAGGGACCACCTCCACCTCCAGGCCCCTT

TCCACCTCGCCCACCAGGTCCACTAGGGCCTCCCCTCACACTTGCTCCTCCTCCACATCTTCCGGGACCACCTCCAGGTGCCCCGCCACCAGCTCCACAT

GTGAATCCTGCTTTTTTTCCTCCACCAACTAATAGTGGCATGCCAACATCAGATAGTCGAGGTCCACCACCAACAGACCCATATGGCCGACCTCCCCCAT

ATGATAGGGGTGACTACGGTCCCCCTGGGAG - UNI5182 - - UNI15756 - GGAAATGGATACTGCAAGAACACCTCTGAGTGAAGCTGAGTTT

GAAGAAATCATGAATAGAAATCGGGCAATCTCAAGCAGTGCTATTTCAAGAGCTGTGTCTGACGCTAGTGCTG - UNI742 - GTGATTATGGGAGTG

CTATTGAAACATTGGTAACAGCAATTTCTTTAATTAAACAATCCAAAGTCTCTGCAGATGATCGTTGCAAAGTTCTTATTAGCTCTCTGCAGGATTGCCT

TCATGGAATCGAGTCCAAGTCCTATGGGTCTGGATCCAG - UNI4332 - ACGTGAACGATCAAGAGAACGGGACCATAGTAGATCACGGGAAAAGAG

TCGTCGCCATAAATCTCGGAGTAGAGATCGCCACGATGACTATTACAGAGAGAGAAGCAGAGAACGAGAGAGACACCGGGATCGGGACCGCGACCGTGAC

CGAGAGCGTGACCGAGAGCGAGAATACCGTCATCGTTAG
Translation
MADGVDHIDIYADVGEEFNQ - UNI24008 - EAEYGGHDQIDLYDDVISPSANNGDAPEDRDYMDTLPPTVGDDVGKGAAPNVVYTYTGKRIALYIG

NLTW - UNI11951 - WTTDEDLTEAVHSLGVNDILEIKFFENRANGQSKG GFALVGVGSEASSKKLMDLLPKRELHGQSPVVTPCNKQFLSQFEMQ

SRKT - UNI15756 - TTQSGQMSGEGKAGPPGGGSRAAFPQGGRGRGRFPGAVPGGDRFPGPAGPGGPPPPFPA - UNI15756 - AGQTPPRPP

LGPPGPPGPPGPPPPGQVLPPPLAGPPNRGDRPPPPVLFPGQPFGQPPLGPLPPGPPPPVPGYGPPPGPPPPQQGPPPPPGPFPPRPPGPLGPPLTLAPP

PHLPGPPPGAPPPAPHVNPAFFPPPTNSGMPTSDSRGPPPTDPYGRPPPYDRGDYGPPGR - UNI5182 - - UNI15756 - REMDTARTPLSEAE

FEEIMNRNRAISSSAISRAVSDASAG - UNI742 - GDYGSAIETLVTAISLIKQSKVSADDRCKVLISSLQDCLHGIESKSYGSGSR - UNI4332

 - RRERSRERDHSRSREKSRRHKSRSRDRHDDYYRERSRERERHRDRDRDRDRERDREREYRHR

For any suggestions or comments, please send an email to unitrap@crg.es