Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000055632 (Hmcn2)
Chromosomal location
Chr 2: 31169935 - 31316234 (+)
Description
hemicentin 2 Gene [Source:MGI (curated);Acc:Hmcn2-001]
UniGene
Mm.80703 Mm.476138 Mm.476581 
MGI
MGI:2677838 
Uniprot/SPTREMBL
Q8BNH3 Q8K061 A2AJ76 
Human Ortholog
ENSG00000148357 (HMCN2)
Omim not available
UniTrap UNI31778
Vector Insertion
Chr 2: 31308685 - 31308902
Public Clones IST14317A9 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 18% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI35339
Vector Insertion
Chr 2: 31309141 - 31310147
Public Clones IST14791D7 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 28% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000060478
Sequence
ATGACTGGAGTCATCAATGGTCAGGAATTTGGAATGGCTACTCTCAACATCAGTGTGCTACAGCAGGGCAGCTCTGAGGCTCCAACCATCTGGAGCAGCA

TCAGTCAAGTCCCAGCAAGTGTGG GGCCTCTAATGCGGGTGCTGGTGGTCACGATTGCCCCCATCTACTGGGCCCTGGCTAGAGAGAGCGGAGAGGCCT

TAAATGGCTACTCTCTGACGGGTGGCAGCTTCCAGCAGGAGTCACAGATGGAATTTTCTACAG GGGAGCTACTCACAATGACCCAGGTGGCTCGGGGCC

TGGATCCTGATGGACTCCTGCTCGTGGACATGAAAATCAATGGCATGATCCCAGAGAGCCTGGCTGACGGAGATCTGCGAGTACAG - UNI31778 - 

GACTTCCAGGAGCACTACGTGCAGACAGGGCCTGGCCAGCTATTTGCGGGCTCCACACAGCGTTTCCTCCACGACAGCCTCCCAGCCTCCCTGCGCTGCA

ATCACAGCATCCAGTATGATGAGACCCGGGGCCTCCAGCCCCAGCTGGTGCAGCATCTTCGGGCCTCTTCTATCAGCTCGGCCTTTGACCCTGAGGCAGA

GGCCCTGAACTTCCAGCTTACCACAGCCCTGCAAACAG - UNI35339 - AGGAAAATGAAGTTGGCTGTCCCGAGGGCTTTGAGCCGGATGTGCAGG

GAGCATTTTGTGTGG ACAAGGACGAATGCTCAGGAGGTCCCAGCCCCTGCTCTCATACCTGCCGCAATGCTCCTGGTCATTTCTCCTGCTCCTGCCCCA

CTGGCTTCTCCCTGGCTTGGGACCACAGGAATTGTAGAG ATGTGGATGAGTGTGCGGGCAACACCCACCTCTGCCAGGAGGAACAGCGCTGTGTGAACC

TGCTTGGATCCTATAACTGCCTCGCTTCCTGTAGACCTGGCTTCCGGGTAACTGCTGACGGAAGCAACTGTGAAG ATGTGGATGAATGTCTAGAACAGC

TGGATGAGTGTCACTACAATCAACTCTGTGAGAACACTCCAGGTGGCCACCACTGTGGTTGTCCCAGAGGGTACCGCCAACAGGGTCACAGCCTGCCTTG

CCTAG ACATCAACGAGTGCCTACAGCTGCCCACACCCTGTGTCTACCAGTGTCAGAACCTCCAGGGCAGCTACCGATGCCTGTGCCCACCAGGCCAGAC

TCTCCTACGGGATGGCAGGACCTGTATCCCCCTGGAACGGAACCGTCAAAACATTACCATTGTCAGCCACCGGAGCCCATTTGGGCCCTGGCTGCGGTCT

CGGGTACCCAGGCCCAGTAGTTCCTACCACACCTGGGTCTCCCTCCGGCCTGGTTCTGGGGCCCTGAATAGTGTGGGCCGGGCCTGGTGCCCACCTGGCT

TCATAAGGCAGGATGGCGTGTGTGCAG ACCTTGATGAGTGCCGTGTTAGGAGCCTGTGTCAGCATGCCTGCCAAAACACAGAGGGTAGCTACTATTGCC

TGTGCCCCTCTGGCTACCGCCTCCTTCCCAGCGGGAAGAACTGCCAGG ACATCAACGAGTGTGAGGAAGATGGCATCGAGTGTGGGCCTGGCCAGATGT

GCTTCAACACCCGAGGCAGCTTCCAGTGTGTAGACACGCCCTGTCCTACCACCTACCGGCAGGGCTCCAGCCCCGG GACCTGCTTCCGCCGCTGCTCTC

AGGACTGCAGCGCCAGCGGCCCGTCTACACTGCAGTACCGCCTGCTGCCGCTGCCCCTCGGCGTGCGCGCCCACCACGACGTGGCCCGCCTGGCCGCCTT

CTCCGAGGCTGGCATCCCTGCCAACCGCACGGAGCTCACCGTGCTGGAGCCCGACCCACGCAGCCCCTTCGCTCTC CCAGCTACGCGCTGGACAAGGCG

CGGTCTACACCCGCAGAGCGCTCACCCGCGCCGGGCTCTACCGCTTGACTGTGCGCGCAGCGGCACCCCGCCACCAGAGCGTCTACATCCTGCTAATCGC

AGTGTCGCCTTACCCGTACTGAGGCCAGAGCTGCAGATCCACCCTGACCTCGCAGAGAGGAACAGAGTGGCCCTTGCCCATGACACCTACAGTGACAGAG

AACATCCTCTTCTCCCGCCCCCGTGCGTCAGTGAGATCTTTGGTAAACACTGCTGTGCGCAGAGCCTTGACCCCAGGGCAGAGACCGCTGCCCCTTTGAT

GGCAAAGCCAATGGGTCAGGCCTGA
Translation
MTGVINGQEFGMATLNISVLQQGSSEAPTIWSSISQVPASVG GPLMRVLVVTIAPIYWALARESGEALNGYSLTGGSFQQESQMEFSTG GELLTMTQV

ARGLDPDGLLLVDMKINGMIPESLADGDLRVQ - UNI31778 - DFQEHYVQTGPGQLFAGSTQRFLHDSLPASLRCNHSIQYDETRGLQPQLVQHLR

ASSISSAFDPEAEALNFQLTTALQTE - UNI35339 - EENEVGCPEGFEPDVQGAFCVD DKDECSGGPSPCSHTCRNAPGHFSCSCPTGFSLAWDH

RNCRD DVDECAGNTHLCQEEQRCVNLLGSYNCLASCRPGFRVTADGSNCED DVDECLEQLDECHYNQLCENTPGGHHCGCPRGYRQQGHSLPCLD DI

NECLQLPTPCVYQCQNLQGSYRCLCPPGQTLLRDGRTCIPLERNRQNITIVSHRSPFGPWLRSRVPRPSSSYHTWVSLRPGSGALNSVGRAWCPPGFIRQ

DGVCAD DLDECRVRSLCQHACQNTEGSYYCLCPSGYRLLPSGKNCQD DINECEEDGIECGPGQMCFNTRGSFQCVDTPCPTTYRQGSSPG GTCFRRC

SQDCSASGPSTLQYRLLPLPLGVRAHHDVARLAAFSEAGIPANRTELTVLEPDPRSPFAL PATRWTRRGLHPQSAHPRRALPLDCARSGTPPPERLHPA

NRSVALPVLRPELQIHPDLAERNRVALAHDTYSDREHPLLPPPCVSEIFGKHCCAQSLDPRAETAAPLMAKPMGQA
Transcript ENSMUST00000074390
Sequence
ATTCTCTGAATAGCTGACGAATGGCCTCAGGGGCCCTCGCTGCTTTCAGGATTCTTGTTTCCCTGTCCACCATCCACCTTACACCCCTTCCTGGCCAGAC

AAGTCTCAGTACAGTTACCTATGTGTGCCCAACTGACCCTCCTCCTCACCTAAGCACCCGCACCCCCCCCCCCCCGCCACCTGCAGATGGACGACGCGGG

ACGGTACCAATGCCTGGCCGTGAACGAGATGGGCACCGTGAAGAAAGTGGTGACAGTTGTGCTTCAGA GTGCCCCAGTGTTCCAGGTGGAGCCTCAGGA

CGTGACAGTGAGGTCCGGAGTGGATGTGGAACTGCGATGCCGGGCCACTGGAGAGCCTGTGCCCACAATCGAGTGGCTACGGGCAGGCAGGCCGCTACAG

GCTGGCCGGAAGCTCCGGGCCCTGCCAGATGGAAGCCTGTGGCTGGAGCATGTGGAAGCTGGAGATGCTGGAGTGTATGAGTGTGTTGCTCACAATCATC

TGGGCTCTGTCACAGCCAAGGCGTTGCTGGCCGTAAGAG GGGAGCCCCGGGGCAGCCGGGGCAGCATGACTGGAGTCATCAATGGTCAGGAATTTGGAA

TGGCTACTCTCAACATCAGTGTGCTACAGCAGGGCAGCTCTGAGGCTCCAACCATCTGGAGCAGCATCAGTCAAGTCCCAGCAAGTGTGG GGCCTCTAA

TGCGGGTGCTGGTGGTCACGATTGCCCCCATCTACTGGGCCCTGGCTAGAGAGAGCGGAGAGGCCTTAAATGGCTACTCTCTGACGGGTGGCAGCTTCCA

GCAGGAGTCACAGATGGAATTTTCTACAG GGGAGCTACTCACAATGACCCAGGTGGCTCGGGGCCTGGATCCTGATGGACTCCTGCTCGTGGACATGAA

AATCAATGGCATGATCCCAGAGAGCCTGGCTGACGGAGATCTGCGAGTACAG - UNI31778 - GACTTCCAGGAGCACTACGTGCAGACAGGGCCTG

GCCAGCTATTTGCGGGCTCCACACAGCGTTTCCTCCACGACAGCCTCCCAGCCTCCCTGCGCTGCAATCACAGCATCCAGTATGATGAGACCCGGGGCCT

CCAGCCCCAGCTGGTGCAGCATCTTCGGGCCTCTTCTATCAGCTCGGCCTTTGACCCTGAGGCAGAGGCCCTGAACTTCCAGCTTACCACAGCCCTGCAA

ACAG - UNI35339 - AGGAAAATGAAGTTGGCTGTCCCGAGGGCTTTGAGCCGGATGTGCAGGGAGCATTTTGTGTGG ACAAGGACGAATGCTCAG

GAGGTCCCAGCCCCTGCTCTCATACCTGCCGCAATGCTCCTGGTCATTTCTCCTGCTCCTGCCCCACTGGCTTCTCCCTGGCTTGGGACCACAGGAATTG

TAGAG ATGTGGATGAGTGTGCGGGCAACACCCACCTCTGCCAGGAGGAACAGCGCTGTGTGAACCTGCTTGGATCCTATAACTGCCTCGCTTCCTGTAG

ACCTGGCTTCCGGGTAACTGCTGACGGAAGCAACTGTGAAG ATGTGGATGAATGTCTAGAACAGCTGGATGAGTGTCACTACAATCAACTCTGTGAGAA

CACTCCAGGTGGCCACCACTGTGGTTGTCCCAGAGGGTACCGCCAACAGGGTCACAGCCTGCCTTGCCTAG ACATCAACGAGTGCCTACAGCTGCCCAC

ACCCTGTGTCTACCAGTGTCAGAACCTCCAGGGCAGCTACCGATGCCTGTGCCCACCAGGCCAGACTCTCCTACGGGATGGCAGGACCTGTATCCCCCTG

GAACGGAACCGTCAAAACATTACCATTGTCAGCCACCGGAGCCCATTTGGGCCCTGGCTGCGGTCTCGGGTACCCAGGCCCAGTAGTTCCTACCACACCT

GGGTCTCCCTCCGGCCTGGTTCTGGGGCCCTGAATAGTGTGGGCCGGGCCTGGTGCCCACCTGGCTTCATAAGGCAGGATGGCGTGTGTGCAG ACCTTG

ATGAGTGCCGTGTTAGGAGCCTGTGTCAGCATGCCTGCCAAAACACAGAGGGTAGCTACTATTGCCTGTGCCCCTCTGGCTACCGCCTCCTTCCCAGCGG

GAAGAACTGCCAGG ACATCAACGAGTGTGAGGAAGATGGCATCGAGTGTGGGCCTGGCCAGATGTGCTTCAACACCCGAGGCAGCTTCCAGTGTGTAGA

CACGCCCTGTCCTACCACCTACCGGCAGGGCTCCAGCCCCGG GACCTGCTTCCGCCGCTGCTCTCAGGACTGCAGCGCCAGCGGCCCGTCTACACTGCA

GTACCGCCTGCTGCCGCTGCCCCTCGGCGTGCGCGCCCACCACGACGTGGCCCGCCTGGCCGCCTTCTCCGAGGCTGGCATCCCTGCCAACCGCACGGAG

CTCACCGTGCTGGAGCCCGACCCACGCAGCCCCTTCGCTCTCCGCCAGCTACGCGCTGGACAAGGCGCGGTCTACACCCGCAGAGCGCTCACCCGCGCCG

GGCTCTACCGCTTGACTGTGCGCGCAGCGGCACCCCGCCACCAGAGCGTCTACATCCTGCTAATCGCAGTGTCGCCTTACCCGTACTGAGGCCAGAGCTG

CAGATCCACCCTGACCTCGCAGAGAGGAACAGAGTGGCCCTTGCCCATGACACCTACAGTGACAGAGAACATCCTCTTCTCCCGCCCCCGTGCGTCAGTG

AGATCTTTGGTAAACACTGCTGTGCGCAGAGCCTTGACCCCAGGGCAGAGACCGCTGCCCCTTTGATGGCAAAGCCAATGGGTCAGGCCTGAGTCCCGTC

TTTCCTCAGATCTCAGCGGGGAGCTGGGCAAGATCTCAGTGGTCCAGGACAGACCCAGTAGGGGTGGAAGCGACTGGCACTGTCCTGACCACATGGAATG

TGTATAGT
Translation
MDDAGRYQCLAVNEMGTVKKVVTVVLQS SAPVFQVEPQDVTVRSGVDVELRCRATGEPVPTIEWLRAGRPLQAGRKLRALPDGSLWLEHVEAGDAGVYE

CVAHNHLGSVTAKALLAVRG GEPRGSRGSMTGVINGQEFGMATLNISVLQQGSSEAPTIWSSISQVPASVG GPLMRVLVVTIAPIYWALARESGEALN

GYSLTGGSFQQESQMEFSTG GELLTMTQVARGLDPDGLLLVDMKINGMIPESLADGDLRVQ - UNI31778 - DFQEHYVQTGPGQLFAGSTQRFLH

DSLPASLRCNHSIQYDETRGLQPQLVQHLRASSISSAFDPEAEALNFQLTTALQTE - UNI35339 - EENEVGCPEGFEPDVQGAFCVD DKDECSG

GPSPCSHTCRNAPGHFSCSCPTGFSLAWDHRNCRD DVDECAGNTHLCQEEQRCVNLLGSYNCLASCRPGFRVTADGSNCED DVDECLEQLDECHYNQL

CENTPGGHHCGCPRGYRQQGHSLPCLD DINECLQLPTPCVYQCQNLQGSYRCLCPPGQTLLRDGRTCIPLERNRQNITIVSHRSPFGPWLRSRVPRPSS

SYHTWVSLRPGSGALNSVGRAWCPPGFIRQDGVCAD DLDECRVRSLCQHACQNTEGSYYCLCPSGYRLLPSGKNCQD DINECEEDGIECGPGQMCFNT

RGSFQCVDTPCPTTYRQGSSPG GTCFRRCSQDCSASGPSTLQYRLLPLPLGVRAHHDVARLAAFSEAGIPANRTELTVLEPDPRSPFALRQLRAGQGAV

YTRRALTRAGLYRLTVRAAAPRHQSVYILLIAVSPYPY
Transcript ENSMUST00000113532
Sequence
ATGACGCCTGGGGCGCAGCTCCTGCCGCTGCTCGTGGCGATCTCTACAGCAGTGGCGGCGGTGGTCACGTCTGACGCGCCCACGAAGACGCTGTCCCCCG

CCACAGGAGACGCCACCCTAGCCTTCGTCTTCGATGTCACCGGCTCCATGTGGGATGACCTGATGCAGGTGATCGACGGCGCCTCGCGCATTCTGGAGCG

CAGCCTGAGCAGCCGCAGCCGGGTCATCGCCAACTATGCGCTGGTGCCTTTCCACGACCCAG ATATTGGCCCGGTGACCCTCACGGCAGACCCAGTGGT

ATTTCAGAGAGAGCTGAGAGAACTCTATGTTCAG GGAGGAGGTGATTGCCCAGAGATGAGTGTGGGGGCCATCAAGGCTGCCGTGGAGGTCGCCAACCC

AGGCTCCTTCATCTACGTCTTCTCGGATGCCCGTGCCAAGGACTACCACAAGAAGAAGGAGCTTCTGCAGCTCCTGCAGCTGAAGCAGTCACAG GTGGT

CTTTGTGCTGACTGGAGACTGTGGTGACCGCACCCATCCTGGCTACCTGGTCTTCGAGGAGATCGCCTCCACCAGTTCTGGCCAGGTGTTCCAGCTGGAC

AAACAGCAGGTGTCGGAG GTGTTAAAGTGGGTGGAGTCAGCAATCCAGGCCTCCAAAGTTCATCTGCTGTCTGCAGACCATGAGGAGGAGGGCGAGCAC

ACGTGGAGAATCCCCTTTGACCCCAGCCTGAAGGAGGTCACCATTGCACTGAGCGGACCAGGGCCTGAGATTGAAGTCCGGGACCCACTGG GAAGGGTC

CTGCAGACGGATGAAGGCCTCAATGTGCTCCTCAACATTCCAGACTCAGCCAAGGTCGTAGCCTTTAAGCCTGAGCACCCAGGACTGTGGGCCATCAAG 

GTATACAGCAGCGGCCGCCACTCAGTGAGGATATCAGGCATCAGCAACATCAACTTCCGAGCCGGCTTCTCCATGCAGCCCTCCCTGGACCTCAACCACA

CCATCGAGTGGCCTTTGCAAG GCGTACCCATCTCCCTGGTGATCAACTCTACGGGCCTGCAGGCACCTGGCCACCTTGAGTCTGTGGAGCTCTCACACA

GCTCGGGGAGGTCCCTTCTCACTCTGCCCACACAACTCCTCTCCAATGGGTCCACCCATCAGCTGTGGGCTGGGCCACCCTTCCACGTGCCGAAGGAACG

CTTTTATCTCAAGGTGAAGGGCAAAGACCACGAGGGGAATCCCCTCCTTCGTGTCTCTGGAGTTTCCTACAGTGCAGTGGCCCCAG GTGTGCCGCTGGT

CAGCATGGCTCCTAAGATCCATGGTTACCTACAGCAGCCCCTGCTGGTGTCCTGCTCTGTGTATAGCACCCTCCCCTTCCAGCTACAGCTGCAGAGAGAT

GGAGAGAGGCTGGGCGAGGAGCGGTACTTTCA AGAGTCGGGAAACAGCAGCTGGGAGATCCCGAGAGCCTCTAAGGCTGAGGAAGGCACGTACCAGTGC

ATAGCCGTCAGCAGAGCTGGGTCAGGACGAGCCAGCGCCCAGATTGTCATCACAG ACCCTCCACCACAGCTGGTCCCTGGCCCCAATGTGACCGTGTCC

CCAGGGGAGACTGCCATCCTGTCATGCCAAGTCCTAGGTGAAACTCCTTACAACTTGACCTGGGTCCGGGACTGGCGAGCCTTACCAGCCACAACAGGTC

GGATCTCCCAGCTGAGTGACCTGTCTCTGGAAGTCCGCAGCATCATTCCCACTGATGGTGGGCAGTACCAGTGTGTGGCCAGCAACCCAAATGGGGTCAC

GAGGGCAACTACCTGGCTCCTGGTGCGAG AGGCCCCTCAAGTCAGCATCAATGCAAGGTCCCAGCGCTTCTCCCAGGGTGTGGAGGTGAGGGTCAGCTG

CTCAGCCTCTGGGTACCCCACACCCCATATCTCATGGAGCCGTGAAGGCCTCGCCTTGCCAGAGGACAGCAG AATCCATGTGGATGCCCAAGGCACACT

CATCATTCAGGGGTTAGCCCCTGAGGATGCTGGGAACTACAGCTGCCAGGCCACTAATGAAGTTGGCACAGATGAGGAGACAGTCACTCTCTACTACACA

G ATCCACCATCCGTGTCTGCTGTCAATGCTGTGGTTCTCACAGCTGTTGGGGAAGAGGCTGTGCTATTGTGTGCAGCATCTGGGGTCCCCCCACCCCGG

GTCATCTGGTATCGAG GAGGTCTGGAAGTGATTCTGGCTCCTGGAGACTCTAGGTCGGGGACACTGCGGATCCCTGAAGCTCAGGAGAGAGACGCTGGC

CTCTATACCTGCAAGGCTGTGAACGAGCTGGGTGATGCCTCTGCTGAAATACAGCTGGTGGTGGGAA ATGCACCCAGGCTGACGGATCCGCCCCAGGAC

GTCACTGTGGAGCTGGGCAAGAGTGTCTTCCTCACCTGCCGGGCCACAGGCCGCCCACCCCCAATTGTCACTTGGCGGCGTGGAGATGGCCAGGCCCTGG

AGCCTGGGAGGGGGAGCAGAACTGGACAGCGAGATTCAGGAGTCTTGGTCTTTGAAA GAGTCTCCCTGGAAGACCAAGCACCGTATGTGTGTGAAGCTC

GCAATGTGTTCGGGAAGGCCCAGGCTGAGGCCCGGCTGGTAGTCACTGGACATG CACCTCCACAGATCGCCAACAGTGCTTCTGTCGTACGTGTCCTGG

AGGGACAGCCCGTGTCCCTGACCTGTGTCATCCTGGCAGGGAGGCCCCTCCCTGAGAGACGCTGGCTCAAGGCTGGCAGCCCT CTCCCCCCAGGCAACC

GGCATGCTGTCCGTGCTGACGGCAGCCTACACCTTGACCGAGCCCTGCAAGAAGATGCTGGAAGATACAGCTGTGTGGCCACCAATGTGGCAGGCTCTCA

GCACCGAGATGTGGAGCTGGTGGTCCAGG TGCCACCTAGAATCCATCCGACTTCCACCCACCACGTCACCAACGAAGGAGTGCCAGCCTCCCTCCCCTG

CATAGCTTCAGGAGTCCCCACCCCTAAAATCACCTGGACCAAG GAAACCAACGCCTTGACTACCAGCGGTCACTACAGTGTGAGCAGAAATGGTACCCT

GGTCATTGTCCAGCCATCCCCGCAGGATGCAGGTGCCTATGTGTGCACAGCCACCAACAGTGTGGGCTTCTCCAGCCAGGAGATGTGGCTGTCTGTTAAT

A CCAAGCCCATGATCAAGATGAATGGCTCCCAGGCTGTGGATGTCCCTCTGAGAGTGACAGTCAAGGCTGGTGAAGAGGTGACCCTGGACTGTGAGGCC

CAAGGCTCCCCAACTCCACTGCTCACCTGGACCAAGGATGCCAACCCTCTACTGCCTGTCACCAACAG GTATGAGCTCCTCCCATCAGGCTCCCTGCGC

CTGGCACAGGCCCAGGTGGGTGACAATGGCCTTTATGGGTGTACAGCCAGCAACCCCGCGGGGGCCACATCTCGCCGCTACGTCCTCAGAGTTCAAG TC

CCCCCTCAGGTGCAGCCTGGCCCTCGGGTCCTGAAGGTACTGGCTGGAGAAGCCCTTGACCTGAACTGTGTGGCCGAAGGCAACCCCCAACCTCAGCTGA

ACTGGTTCAAGGACGGGATGGCCCTGATGGGCGAGGGAGCCCAGGGCTCTGTCCACTTTGCTGCTGTCAAGACCTCTGATGCTGGGCTGTACCGCTGTGA

GGCCTCCAATAGCGCTGGCACAGATACCTGGAAGCTGGAGCTCCTTGTGCTCG AGCCACCACACTGGGGGACTGACGAGACCAAGAGCCTGCTGGAGCG

AGTGGCCGGAGAGAATGCCAGTCTGCCATGTCCTGCCCAAG GGACTCCAAAGCCACGAATCACATGGCGGAGGGGCCCATCCTCAGAGCCCCTGAATGG

CCGGCCAGATGTGGCGGTGCTGGATGAAGGGTCGCTGTTCCTGTCCTCAGTCTCTCTTGCAGACAGCGGGGAGTACGAGTGCCAGGCCACCAATGAGGTG

GGCTCTGCATCCAGGAGAGCCAAGCTGGTGGTCTATG TGCCCCCCAGCATCCGGGAAGAGGGGCACATAACCAACGTGTCGGGCCTAGCTGGACAGCCC

CTGACGCTGGAGTGTGACATAAACGGCTTTCCTGCCCCTGAGGTGGCGTGGCTCAAGGATGGGCAGCTGGTGGGTGACTCCGGGGGAGGTTGGGATGGGG

AAG AGGCAAGTGGACATCGCCTCTTGGATGGCTCCCGGTCCCTCCACTTCCCTAGGATCCAAGAGAGCCATTCTGGCCTCTATTCCTGCCAGGCTGAGA

ATCAGGCGGGGAGCGCCCAGAGAGACTTCAATCTTGCTGTGTTCA TCCCTCCCTCCTTGCTGGGAGCTGGGGCCGCTCAGGAGGTGCTTGGCCTGGCTG

GTGCTGATGTGACATTGGAGTGTCAGACCTCAGGGGTTCCCACGCCCCAGGTGGAGTGGACCAAGGATGGGCA GCCTATCCTTCCAGGGGATCCTCACA

TCCTGCTGCAGGAGGATGGCCAAGTTCTCAGAATTATCAGCAGTCACTTAGGTGACGAAGGGCAGTATCAGTGTGTGGCCTTCAGCCCAGCCGGCCAGCA

GGCCAAGGACTTTCAGCTCAGCATTCACT CACCACCCACCATCTGGGGCTCGAATGAGACAGGTGAGGTGACTGTCCTGGAGGGCCACACCGCACAGCT

CCTATGTGAGGCCCGAGGAATGCCATCCCCTGCCATCACCTGGTACAAGGATGGGACCCTGCTGGCCCCCAGCTCAGAAGTGGTTTACAGCAAGGGCGGC

CGGCAGCTGCAGCTGGTGAAGGCCCAGCCCTCCGATGCTGGCCTCTACACCTGCCAGGCCAGCAACCCTGCAGGGATTACGAAGAAATCCACCAGTCTGG

AGGTTTATG TTCCACCTACCATTGAGGGTGCTGACGGAGGGCCATACCTGGTGCAGGCTGTGGCTGGGAGACCCGTGGCACTGGAGTGTGTGGCCAGAG

GCCATCCACCCCCTACGATCTCCTGGCAGCATGAAGGGCTGCCAGTGGTGGACAGTAATGGGACATGGCTGGAGGCAGGAGGTGCCCTGCAGCTGGAGAA

CCCAGGAGAGGCATCCGGTGGCCTCTACAGCTGTGTGGCCAGCAGCCCCGCTGGAGAGGCTGTACTGCAGTACTCAGTGGAGATGCAGG TGCCCCCACA

GCTGCTGGTGGCTGAAGGCATGGGCCAGGTCACTGCCACCGTGGGACAGTCTCTGGATCTTCCCTGCCAGGCATCAGGCTCCCCAGTGCCCACCATCCA 

ATGGTTACAGAATGGTCGCCCAGCAGAGGAGCTGGCTGGGGTGCAGCTGGCCTCACAGGGGACCATACTGCACATCAGCCACGTGGAGCTGAACCACTCA

GGCCTCTTTGCCTGCCAGGCCACCAACGAGGCAGGAACAGCTGGGGCTGAGGTGGAGGTCTCTGTGCATGGTAAGCAGGTATCTGTGAATCTGGG AGCT

TCCTTCAGTGCACATCATTGGTGGGGAGAACCTCACAGCCCCTTTCCTGCAACCTGTAACCCTCCAGTGTGTAGGCATTGGAGTGCCTACCCCAAGCCTT

CGCTGGTGGAAAGATGGCGTGGCCGTGGCAACCTCAGGGGGCAACCTTCAGGTACAGTTAGGGAACCAGGACTG ACCCTTCTCTCCCAGATTGAGAAGG

CAGACCTGAGAGATGAAGGTGTCTACACGTGTTCAGCCACCAACCTGGCAGGGGAGAGCAAGAAGGATGTAACACTAAAGGTTCTGG TTCCTCCCAACA

TTGAACCAGGCCCAGTCAACAAGGTGGTTCTGGAGAATGCCTCTGTGACCTTGGAGTGTCTGGCTTCCGGTGTCCCCCCTCCAG ACGTCTCCTGGTTCA

AGGGTCGCCAGCCCATCTCTACCCAGAGACGGGTGATAGTGTCAGCTGATGGAAGAGTTCTTCATATTGAGCGAGTCCAGCTTTCTGATGCAGGGAGCTA

CCGCTGTGTGGCGACCAATGTGGCGGGCAGTGCAGGGCTGAAGTATGGCCTACGGGTCAATG TGCCACCCCGAATTACCCTGCCACCCAACCTACCAGG

CCCAGTACTGCTTGGCACACCCTTCCGCCTGACCTGTAATGCCACTGGCACCCCCCGCCCCACCCTGATATGGCTGAAGGATGGAAACCCTGTGTCTCCT

GAAGGAATCCCTGGCCTCAAG GTCTTCCCCGGAGGACAGGTCCTCACTGTGGCCAGTGCCCGTGCCTCTGATTCGGGCAGCTACTCCTGTGTAGCAGTG

AGTGCTGTGGGTGAGGATCGCCGGGATGTCATCCTGCAAGTTCACA TGCCCCCCAGCATCCTCGGAGAAGAGCTAAACATGTCCGTCGTCGTAAATGAG

TCAGTGACCCTGGAGTGCCAGAGCCATGCAGTGCCACCACCCGTGCTGAGATGGCAGAAGGACGGGAGACCCCTGGAGCCTCACCCTGGGATCCGCCTCT

CTGCAGACAAGGCCTTGCTGGAG GTGGACCGAGCGGCGGTGTGGGATGCAGGCCACTACACCTGTGAAGCTATTAACCAGGCAGGCCGCTCTGAGAAAC

ACTTCAACTTGCATGTCTGGG TCCCTCCAGCGTTCCCCTCAAAGGAGCCCTACACTCTCACTGTGACTGAGGGACAGACCGCCAGACTGTCGTGTGACT

GCCAGGGCATTCCTTTCCCCAAGATCTCATGGAGGAAAGATG GTCAGCCTCTGCCTGGGGAGGGGGACAGCCTGGAACAGGTGTTGGCAGTCGGGAGGC

TGCTGTACCTGGGACAGGCCCAGTCGGCCCAGGAGGGGACATATACCTGTGAATGCAGCAATGCAGCCGGGACCAGCAGCCAGGAGCAGTCGCTGGAGGT

TCTGG TTCCTCCTCAGGTCACTGGCCTCTGGGAGCCCCTCACAACAGTCTCCGTGATCCAGGATGGAAACACCACCCTGGCCTGTAATGCCACAGGGAA

GCCCCTCCCAGTGGTGACATGGCAGAGGGATGGTCAGCCTGTCTCGGTGGAACCCGGCTTGCGGCTTCAGAATCAGAACCACAGCCTACACGTGGAACGG

GCTCAGGCCTCCCACGCCGGCGGCTACAGCTGTGTGGCTGAGAATACAGCTGGGCGTGCCGAGAGGAGGTTTGCACTGTCTGTGCTGG CACCTCCTCAT

CTTACTGGAGACTCAGACTCACTGACCAATGTCACTGCTACCTTACACGGCTCCTTCACACTGCTCTGTGAAGCTGCAGGGGTCCCGGCCCCAACAGTCC

AGTGGTTTCAGGAAGGACAGCCAATCAGCCCCAGAGAGGGCACCTATCTCTTGGCAG GTGGCTGGATGCTGAAGATGACCCAGGCACAGGAGCAGGACA

GAGGCCTCTATTCGTGCCTGGCCAGCAATGAGGCTGGGGAGGCACGGAGGAACTTCAGTGTAGAGGTCTTGG TTCCTCCCAGCATTGAAAATGAAGACT

TGGAGGAAGTGATCAAGGTGCCTGAGGGACAGACTGCCCAGCTGGAGTGCAACGCCACAG GCCACCCACCGCCCAAGGTCACATGGTTCAAAGATGGCC

AGTCCCTGACTGTTGAAGACCCTTATGAGATGTCCCCAGATGGGGCCTTCCTGTGGATCCCCCAGGCCAATCTGTCCAATGCTGGCCACTATTCTTGCAT

TGCTAGCAATGCTGTGGGGGAGAAGACCAAACACACACAGCTCAGTGTCCTGG TGGTTCCCACCATCCTGGGAGTGCCAGAGAAGAATGCCAACGAGGA

AGTGACTGTGACCATCAACAATCCTATTTCCTTGATCTGTGAGGCTCTGGCCTTTCCATCCCCCAATATCACCTGGATGAAGGATGGGTCGCCCTTTGAG

GCCTCAAAAAACATTCAGCTCCTCCCAG GTACCCACGGACTACAGATCCTGAATGCCCAGAAGGAAGATGCCGGCCAGTACACCTGTGTAGTCACCAAT

GAGCTGGGGGAGGCGACAAAGAACTACCATGTGGAAGTGCTCA TTCCCCCTTCCATCTCCAAAGATGACCCCTTGGGGGAGGTCAGCGTGAAGGAAGTG

AAGACCAAGGTCAACAGCTCTCTGACCCTGGAGTGTGAATGCTGGGCCACACCCCCGCCCTCCATCAGCTGGTACAAAGACGGAAGG CCTGTGACCCCC

AGCCACCGGCTCAGTGTCCTGGGGGAGGGGCGGCTGCTCCAGATCCAACCCACACAGGTCTCTGACTCTGGCCGATACCTGTGTGTGGCCACCAATGTGG

CTGGCGAGGACGACCAGGACTTCAATGTTCTCATCCAAG TGCCCCCTATGTTCCAGAAGATGGGCGATGTTGATGCAGGCTTTGAGCCCCTGCCCCATG

AGGAGGAGGCCCAGGGCAGGGTGACAGAGTACAGAGAGATTGTGGAGAACAACCCAGCTTACCTGTACTGCGATACCAATGCCATTCCACCACCAGAGCT

CACGTGGTACAGGGAGGGTCAGCCCCTGTCAGCTGCTGATGGGGTCTCGGTACTGCAAG GAGGCCGAATCCTGCAGCTGCCTCTTGTGCAGGCAGAGGA

TGCGGGCAGGTACTCCTGCAAGGCTGCCAATGAGGTGGGCGAGGACTGGCTACATTACGAACTACTGGTGTTGA CACCACCAGTGATCCCGGGAGACAC

ACAGGAGCTGGTAGAGGAGGTGACAGTGAACGCTAGCAGTGCTGTCAGCCTAGAGTGCCCAGCCCTGGGGAACCCAGCACCTGCTGTGTCATGGTTCCAG

AATGGGCTGCCTGTGTCCCCCAGCCCACGGCTGCAGGTCCTAGAGGAGGGACAGGTCTTGAAG GTTGCCACTGCAGAGGTAGCCGATGCCGCCAGCTAC

ATGTGTGTTGCAGAGAACCAGGCAGGCTCTGCAGAGAAACTCTTTACCCTCAAGGTCCAAG TACCGCCACAAATCTCAGACTGGACCACCAGCCAGCTC

ACCGCCACCCTCAACAGCAGTGTCTCCCTCCCCTGTGAAGTTTATGCTCACCCAAACCCTGAGGTCACATGGTACAAGGATGGCCAGCCTCTCTCCCTGG

GACAAGAGGCTTTCCTCCTCCCCG GTACCCACACTCTGCGGCTGGCACGAGCACAGCCAGCTGACTCCGGGACCTACTTGTGTGAAGCCCTCAACGCCG

CAGGCCGAGACCAAAAGATGGTACAGCTCAACGTTCTCG TTCCCCCCAGCTTTAAACAGGCTCCTGGAGGCCCCCAGGAGGCTATCCAGGTTAGAGCAG

GGGACAAAGCCATCCTAAGCTGCGAGACAGACTCACTCCCAGAGCCAGCTGTGACCTGGTTCAAGGACCAGCAGCCCCTAGCCCTGGGGCAGCGGATTCA

GGGTCTACAAGGTGGACAAACACTGGAGATCCTGGACTCACAG GCATCAGATAAGGGTGTGTACAGCTGCAAAGTTAGCAATACAGCTGGAGAGGCCAT

CCGGACCTTTGTCCTTGCCATCCAAG TGCCTCCAACATTTGAGAAGCCCGAGAGGGAGACAGTGAACCAGGTAGCTGGGCGGACCCTAGTCCTGGCTTG

TGATGTGTCCGGAATCCCTGCTCCCACTGTGACTTGGCTGAAGGACAGATTACCCGTGG AGAGCAGCGTGGTACACGGAGTGGTCTCCCGAGGTGGCCG

CCTCCAGCTGAGTCACCTGCAGCCAGCCCAGGCCGGTACCTACACTTGTGTGGCTGAGAACGCCCAGGCAGAGGCCCGCAAAGACTTTGTAGTGTCTGTC

CTAG TGCCTCCCCAGATCCAGGACTCAGGCATGGCACAAGAACACAATGTGTTGGAGAAACAGGAGATTCGGCTGCACTGTGAGGCTGAAGGCCAGCCA

CCACCAGATATAACCTGGCTGAAGGACGGTGGCCTGTTGGACCAGCACGTGGGACCTCACCTCCG GTTCTATCTGGACGGCAGTACCCTGGTGCTGAAG

GGCCTAAGAACAGCGGACTCGGGTGCCTACACCTGTGTGGCCCACAACCCAGCTGGGGAGGATGCCAGGCTACACACGGTGAATGTACTGG TTCCTCCC

ACCATCAAGCAACAAGCTGGTGACACCGGGACCCTGGTGAGCAGGACTGGAGAGCTGGTGACCATGGTGTGCCCTGTCCAAGGATCCCCACCCATTCACG

TGAGCTGGCTCAAGGACGGCCTGCCCCTTCCACTCTCCCAGCGCACCCTCCTCCACAGCTCCGGCCGCACCCTCAG GATCTCTCAGGTGCAGCTGGCAG

ATTCAGGCGTCTTCACCTGTGTGGCTGCAAGCCCAGCTGGTGTGGCTGACAGGAACTTCACCTTGCTAGTACTCG TGCCCCCCATCCTGGAACCAGTGG

AGTTTCAGAACAACGTGATGGCTGCCCAAGGCTCTGAAGTAGTCCTTCCGTGTGAGGCCCGGGGAAGCCCCCTGCCTCTCGTGTCATGGATGAAAGATGG

GGAGCCTTTGTTGCCCCAGAGCCTTGAGCAGGGGCCTGGCCTGAAGCTGGAATCAGTGAGTGTTGGTGACGCAGGGACCTACTCCTGCACGGCAGCAAGC

GAGGCAGGGGAGGCCAGGAGGCACTTCCAGCTGACAGTGATGG ATCCCCCTCACATTGAGGAATCTGGTGAGACTTCAGAGCTGTCACTGACACCCGGT

GCCCACCTGGAACTCCTGTGTGAGGCCCGAGGCATCCCTCCACCCAACATCACTTGGCATAAAGACGGGCAGGCCCTGCGCAGGACGGAAAATGACAGCC

AAGCTGGCCGGGTGCTCCGG GTGGACAATGCTGGGCTGTATACCTGCCTGGCTGAGAGCCCTGCAGGTGAAGTTGAGAAGAGCTTCCGGGTCAGGGTTC

AAG CCCCTCCAAATGTTGTTGGGCCCCGGGGTCCCCGCTCTGTGGTTGGCTTGGCTCCAGGGCAGCTGATCCTGGAGTGCTCCGTGGAGGCAGAGCCAG

CACCAGAGATTGAGTGGCATCGAGGTGGTGTCCTGCTTCAG GCAGATGCCCACACTCACTTTCCAGAGCAGGGCAGATTCCTCAAGCTGCAGGCGCTGA

GCACCGCGGATGGTGGGGACTACAGCTGCACAGCCCGCAACAGGGCAGGCAGCACCAGCGTGGCTTTCCGTGTGGAGATCCACA CGGCACCCACCATCC

AATCAGGACCGAACACTGTGAACGTCTCAGTGAACCGCACAACCCTGCTGCCCTGCCAGACCCACGGTGTGCCCACGCCCCTCGTGAGCTGGAGGAAGGA

TGGGATCCCTCTGCACCCTGGGAGCCCCAG GCTAGAGTTTCTGCCCGAGGGATCACTGCGGATTCATCCAGTCCTGGCACAGGATGCCGGACACTACCT

CTGCCTAGCATCCAACTCTGCTGGCTCCGACCGGAAAGGCCTAGACCTCAGAGTCTTCG AGCCCCCGGCCATTGCTCCTGGCCCCTCCAACCTGACCCT

GACGGCCTACAGCCCAGCCTCGCTGCCCTGTGAAGCCAGAGGCTCTCCCAAGCCCTTGGTGACCTGGTGGAAGGATGGGCAGAAGCTGGACCTCCGCCTA

CAGCAAGGCGCCTACCG GCTTCTGCCTTCCAATGCCCTGTTCCTCACCGCTCCCAGCCCTCAGGACTCAGCCCAGTTTGAGTGTGTCGTGAGCAATGAG

GTGGGAGAGTCCCGCAGGCGCTACCAGGTGACCGTCCATG TGCCTCCCACCATTGCGGACGACCAGACACATTTCACGGTGACCAGGATGGCACCTGTG

ATCCTCACGTGCCACAGCACAGGGTCACCAACCCCAGCCGTGTCCTGGAGCAAGGCAGGCACCCAGCTGGGAGCAAGGGGCAGCGGCTACCGCATCTTGC

CCTCTG GAGCCCTGGAGATTGAGCGGGCCCTCCCTCTCCATGCTGGCCGGTACACCTGCACAGCTCGAAACTCTGCAGGGGTGGCCCGCAAGCACATGG

TCCTCACAGTGCAAG CCTCCCCTGTGGTAAAGCCACTCCCCAGCGTGGTTCAGGTTGTGGCATCGGAGGAGGTGCTGCTGCCCTGTGAGGCCTCTGGCA

TCCCCCAGCCAATGGTCATCTGGCAGAAGGAGGGTCTCAGCATCCCTGAAG GAGCTCATATGCAGGTCCTCCCCAGCGGCCAGCTGCGGATCATGCACG

CCAGCCCAGAGGATGCTGGGAACTACTTCTGCATTGCCCAGAACAGCGTGGGCAGTGCCATGGCGAAGACCAGGCTGGTGGTGCAAG TCCCGCCTGTGA

TTGAGAATGGCCTCCCAGATTTGTCCACCATTGAGGGCTCCCACGCCCTCCTGCCCTGCACAGCCAAGGGCAGCCCTGAACCAGCCATTACCTGGGAAAA

GGATGGCCACCTGGTATCTGGAGCTGAGGGGAAGTTTACCCTGCAGCCTTCCGGGGAGCTCCTGGTGAAGAACTCTGAG GGCCAGGATGCAGGCACTTA

CATCTGCACTGCAGAAAATGCCGTGGGCCGTGCCCGACGCCGCGTGCATCTCACCATCCTGACGCTGCCTGTCCTCACCACCTTGCCTGGGGACCGAAGC

CTGCGTCTTGGGGACAGGCTATGGCTTCGCTGTGTGGCCAGGGGCAGCCCAACACCCCGCATTGGCTGGACCATCAATGACCAGCCTGTCACAG AGGGG

GTGTCTGAGCAGGACGGGGGCAGCACACTGCAGCGGGCAGCCGTCACCAGAGAGGACAGCGGCACATACACGTGCTGGGCCGAGAACAGAGTTGGTCGTG

TGCAGGCTGTCAGCTTCGTCCACGTGAAGG AGGCTCCAGTCCTACAAGGGGAGGCCTTCTCTTACCTGGTAGAACCTGTAGGGGGCAGCATCCAGCTAC

ACTGTGTGGTTCGTGGAGACCCAGCTCCAGACATCCACTGGACCAAAGATGGCCTTCCACTGCCCATCAGCCGCCTCCACTTCCAGCTACAGAACGGCTC

CCTGACCATCCTCAGGACCAAG ATGGACGACGCGGGACGGTACCAATGCCTGGCCGTGAACGAGATGGGCACCGTGAAGAAAGTGGTGACAGTTGTGCT

TCAGA GTGCCCCAGTGTTCCAGGTGGAGCCTCAGGACGTGACAGTGAGGTCCGGAGTGGATGTGGAACTGCGATGCCGGGCCACTGGAGAGCCTGTGCC

CACAATCGAGTGGCTACGGGCAGGCAGGCCGCTACAGGCTGGCCGGAAGCTCCGGGCCCTGCCAGATGGAAGCCTGTGGCTGGAGCATGTGGAAGCTGGA

GATGCTGGAGTGTATGAGTGTGTTGCTCACAATCATCTGGGCTCTGTCACAGCCAAGGCGTTGCTGGCCGTAAGAG GGGAGCCCCGGGGCAGCCGGGGC

AGCATGACTGGAGTCATCAATGGTCAGGAATTTGGAATGGCTACTCTCAACATCAGTGTGCTACAGCAGGGCAGCTCTGAGGCTCCAACCATCTGGAGCA

GCATCAGTCAAGTCCCAGCAAGTGTGG GGCCTCTAATGCGGGTGCTGGTGGTCACGATTGCCCCCATCTACTGGGCCCTGGCTAGAGAGAGCGGAGAGG

CCTTAAATGGCTACTCTCTGACGGGTGGCAGCTTCCAGCAGGAGTCACAGATGGAATTTTCTACAG GGGAGCTACTCACAATGACCCAGGTGGCTCGGG

GCCTGGATCCTGATGGACTCCTGCTCGTGGACATGAAAATCAATGGCATGATCCCAGAGAGCCTGGCTGACGGAGATCTGCGAGTACAG - UNI31778

 - GACTTCCAGGAGCACTACGTGCAGACAGGGCCTGGCCAGCTATTTGCGGGCTCCACACAGCGTTTCCTCCACGACAGCCTCCCAGCCTCCCTGCGCT

GCAATCACAGCATCCAGTATGATGAGACCCGGGGCCTCCAGCCCCAGCTGGTGCAGCATCTTCGGGCCTCTTCTATCAGCTCGGCCTTTGACCCTGAGGC

AGAGGCCCTGAACTTCCAGCTTACCACAGCCCTGCAAACAG - UNI35339 - AGGAAAATGAAGTTGGCTGTCCCGAGGGCTTTGAGCCGGATGTGC

AGGGAGCATTTTGTGTGG ACAAGGACGAATGCTCAGGAGGTCCCAGCCCCTGCTCTCATACCTGCCGCAATGCTCCTGGTCATTTCTCCTGCTCCTGCC

CCACTGGCTTCTCCCTGGCTTGGGACCACAGGAATTGTAGAG ATGTGGATGAGTGTGCGGGCAACACCCACCTCTGCCAGGAGGAACAGCGCTGTGTGA

ACCTGCTTGGATCCTATAACTGCCTCGCTTCCTGTAGACCTGGCTTCCGGGTAACTGCTGACGGAAGCAACTGTGAAG ATGTGGATGAATGTCTAGAAC

AGCTGGATGAGTGTCACTACAATCAACTCTGTGAGAACACTCCAGGTGGCCACCACTGTGGTTGTCCCAGAGGGTACCGCCAACAGGGTCACAGCCTGCC

TTGCCTAG ACATCAACGAGTGCCTACAGCTGCCCACACCCTGTGTCTACCAGTGTCAGAACCTCCAGGGCAGCTACCGATGCCTGTGCCCACCAGGCCA

GACTCTCCTACGGGATGGCAGGACCTGTATCCCCCTGGAACGGAACCGTCAAAACATTACCATTGTCAGCCACCGGAGCCCATTTGGGCCCTGGCTGCGG

TCTCGGGTACCCAGGCCCAGTAGTTCCTACCACACCTGGGTCTCCCTCCGGCCTGGTTCTGGGGCCCTGAATAGTGTGGGCCGGGCCTGGTGCCCACCTG

GCTTCATAAGGCAGGATGGCGTGTGTGCAG ACCTTGATGAGTGCCGTGTTAGGAGCCTGTGTCAGCATGCCTGCCAAAACACAGAGGGTAGCTACTATT

GCCTGTGCCCCTCTGGCTACCGCCTCCTTCCCAGCGGGAAGAACTGCCAGG ACATCAACGAGTGTGAGGAAGATGGCATCGAGTGTGGGCCTGGCCAGA

TGTGCTTCAACACCCGAGGCAGCTTCCAGTGTGTAGACACGCCCTGTCCTACCACCTACCGGCAGGGCTCCAGCCCCGG GACCTGCTTCCGCCGCTGCT

CTCAGGACTGCAGCGCCAGCGGCCCGTCTACACTGCAGTACCGCCTGCTGCCGCTGCCCCTCGGCGTGCGCGCCCACCACGACGTGGCCCGCCTGGCCGC

CTTCTCCGAGGCTGGCATCCCTGCCAACCGCACGGAGCTCACCGTGCTGGAGCCCGACCCACGCAGCCCCTTCGCTCTCCGCCAGCTACGCGCTGGACAA

GGCGCGGTCTACACCCGCAGAGCGCTCACCCGCGCCGGGCTCTACCGCTTGACTGTGCGCGCAGCGGCACCCCGCCACCAGAGCGTCTACATCCTGCTAA

TCGCAGTGTCGCCTTACCCGTACTGAGGCCAGAGCTGCAGATCCACCCTGACCTCGCAGAGAGGAACAGAGTGGCCCTTGCCCATGACACCTACAGTGAC

AGAGAACATCCTCTTCTCCCGCCCCCGTGCGTCAGTGAGATCTTTGGTAAACACTGCTGTGCGCAGAGCCTTGACCCCAGGGCAGAGACCGCTGCCCCTT

TGATGGCAAAGCCAATGGGTCAGGCCTGAGTCCCGTCTTTCCTCAGATCTCAGCGGGGAGCTGGGCAAGATCTCAGTGGTCCAGGACAGACCCAGTAGGG

GTGGAAGCGACTGGCACTGTCCTGACCACATGGAATGTGTATAGT
Translation
MTPGAQLLPLLVAISTAVAAVVTSDAPTKTLSPATGDATLAFVFDVTGSMWDDLMQVIDGASRILERSLSSRSRVIANYALVPFHDPD DIGPVTLTADP

VVFQRELRELYVQ GGGDCPEMSVGAIKAAVEVANPGSFIYVFSDARAKDYHKKKELLQLLQLKQSQ VVFVLTGDCGDRTHPGYLVFEEIASTSSGQVF

QLDKQQVSE VLKWVESAIQASKVHLLSADHEEEGEHTWRIPFDPSLKEVTIALSGPGPEIEVRDPLG GRVLQTDEGLNVLLNIPDSAKVVAFKPEHPG

LWAIK VYSSGRHSVRISGISNINFRAGFSMQPSLDLNHTIEWPLQG GVPISLVINSTGLQAPGHLESVELSHSSGRSLLTLPTQLLSNGSTHQLWAGP

PFHVPKERFYLKVKGKDHEGNPLLRVSGVSYSAVAPG GVPLVSMAPKIHGYLQQPLLVSCSVYSTLPFQLQLQRDGERLGEERYFQ QESGNSSWEIPR

ASKAEEGTYQCIAVSRAGSGRASAQIVITD DPPPQLVPGPNVTVSPGETAILSCQVLGETPYNLTWVRDWRALPATTGRISQLSDLSLEVRSIIPTDGG

QYQCVASNPNGVTRATTWLLVRE EAPQVSINARSQRFSQGVEVRVSCSASGYPTPHISWSREGLALPEDSR RIHVDAQGTLIIQGLAPEDAGNYSCQA

TNEVGTDEETVTLYYTD DPPSVSAVNAVVLTAVGEEAVLLCAASGVPPPRVIWYRG GGLEVILAPGDSRSGTLRIPEAQERDAGLYTCKAVNELGDAS

AEIQLVVGN NAPRLTDPPQDVTVELGKSVFLTCRATGRPPPIVTWRRGDGQALEPGRGSRTGQRDSGVLVFER RVSLEDQAPYVCEARNVFGKAQAEA

RLVVTGHA APPQIANSASVVRVLEGQPVSLTCVILAGRPLPERRWLKAGSP LPPGNRHAVRADGSLHLDRALQEDAGRYSCVATNVAGSQHRDVELVV

QV VPPRIHPTSTHHVTNEGVPASLPCIASGVPTPKITWTK ETNALTTSGHYSVSRNGTLVIVQPSPQDAGAYVCTATNSVGFSSQEMWLSVNT TKPM

IKMNGSQAVDVPLRVTVKAGEEVTLDCEAQGSPTPLLTWTKDANPLLPVTNR RYELLPSGSLRLAQAQVGDNGLYGCTASNPAGATSRRYVLRVQV VP

PQVQPGPRVLKVLAGEALDLNCVAEGNPQPQLNWFKDGMALMGEGAQGSVHFAAVKTSDAGLYRCEASNSAGTDTWKLELLVLE EPPHWGTDETKSLLE

RVAGENASLPCPAQG GTPKPRITWRRGPSSEPLNGRPDVAVLDEGSLFLSSVSLADSGEYECQATNEVGSASRRAKLVVYV VPPSIREEGHITNVSGL

AGQPLTLECDINGFPAPEVAWLKDGQLVGDSGGGWDGEE EASGHRLLDGSRSLHFPRIQESHSGLYSCQAENQAGSAQRDFNLAVFI IPPSLLGAGAA

QEVLGLAGADVTLECQTSGVPTPQVEWTKDGQ QPILPGDPHILLQEDGQVLRIISSHLGDEGQYQCVAFSPAGQQAKDFQLSIHS SPPTIWGSNETGE

VTVLEGHTAQLLCEARGMPSPAITWYKDGTLLAPSSEVVYSKGGRQLQLVKAQPSDAGLYTCQASNPAGITKKSTSLEVYV VPPTIEGADGGPYLVQAV

AGRPVALECVARGHPPPTISWQHEGLPVVDSNGTWLEAGGALQLENPGEASGGLYSCVASSPAGEAVLQYSVEMQV VPPQLLVAEGMGQVTATVGQSLD

LPCQASGSPVPTIQ QWLQNGRPAEELAGVQLASQGTILHISHVELNHSGLFACQATNEAGTAGAEVEVSVHGKQVSVNLG GASFSAHHWWGEPHSPFP

ATCNPPVCRHWSAYPKPSLVERWRGRGNLRGQPSGTVREPGL TLLSQIEKADLRDEGVYTCSATNLAGESKKDVTLKVLV VPPNIEPGPVNKVVLENA

SVTLECLASGVPPPD DVSWFKGRQPISTQRRVIVSADGRVLHIERVQLSDAGSYRCVATNVAGSAGLKYGLRVNV VPPRITLPPNLPGPVLLGTPFRL

TCNATGTPRPTLIWLKDGNPVSPEGIPGLK VFPGGQVLTVASARASDSGSYSCVAVSAVGEDRRDVILQVHM MPPSILGEELNMSVVVNESVTLECQS

HAVPPPVLRWQKDGRPLEPHPGIRLSADKALLE VDRAAVWDAGHYTCEAINQAGRSEKHFNLHVWV VPPAFPSKEPYTLTVTEGQTARLSCDCQGIPF

PKISWRKDG GQPLPGEGDSLEQVLAVGRLLYLGQAQSAQEGTYTCECSNAAGTSSQEQSLEVLV VPPQVTGLWEPLTTVSVIQDGNTTLACNATGKPL

PVVTWQRDGQPVSVEPGLRLQNQNHSLHVERAQASHAGGYSCVAENTAGRAERRFALSVLA APPHLTGDSDSLTNVTATLHGSFTLLCEAAGVPAPTVQ

WFQEGQPISPREGTYLLAG GGWMLKMTQAQEQDRGLYSCLASNEAGEARRNFSVEVLV VPPSIENEDLEEVIKVPEGQTAQLECNATG GHPPPKVTW

FKDGQSLTVEDPYEMSPDGAFLWIPQANLSNAGHYSCIASNAVGEKTKHTQLSVLV VVPTILGVPEKNANEEVTVTINNPISLICEALAFPSPNITWMK

DGSPFEASKNIQLLPG GTHGLQILNAQKEDAGQYTCVVTNELGEATKNYHVEVLI IPPSISKDDPLGEVSVKEVKTKVNSSLTLECECWATPPPSISW

YKDGR PVTPSHRLSVLGEGRLLQIQPTQVSDSGRYLCVATNVAGEDDQDFNVLIQV VPPMFQKMGDVDAGFEPLPHEEEAQGRVTEYREIVENNPAYL

YCDTNAIPPPELTWYREGQPLSAADGVSVLQG GGRILQLPLVQAEDAGRYSCKAANEVGEDWLHYELLVLT TPPVIPGDTQELVEEVTVNASSAVSLE

CPALGNPAPAVSWFQNGLPVSPSPRLQVLEEGQVLK VATAEVADAASYMCVAENQAGSAEKLFTLKVQV VPPQISDWTTSQLTATLNSSVSLPCEVYA

HPNPEVTWYKDGQPLSLGQEAFLLPG GTHTLRLARAQPADSGTYLCEALNAAGRDQKMVQLNVLV VPPSFKQAPGGPQEAIQVRAGDKAILSCETDSL

PEPAVTWFKDQQPLALGQRIQGLQGGQTLEILDSQ ASDKGVYSCKVSNTAGEAIRTFVLAIQV VPPTFEKPERETVNQVAGRTLVLACDVSGIPAPTV

TWLKDRLPVE ESSVVHGVVSRGGRLQLSHLQPAQAGTYTCVAENAQAEARKDFVVSVLV VPPQIQDSGMAQEHNVLEKQEIRLHCEAEGQPPPDITWL

KDGGLLDQHVGPHLR RFYLDGSTLVLKGLRTADSGAYTCVAHNPAGEDARLHTVNVLV VPPTIKQQAGDTGTLVSRTGELVTMVCPVQGSPPIHVSWL

KDGLPLPLSQRTLLHSSGRTLR RISQVQLADSGVFTCVAASPAGVADRNFTLLVLV VPPILEPVEFQNNVMAAQGSEVVLPCEARGSPLPLVSWMKDG

EPLLPQSLEQGPGLKLESVSVGDAGTYSCTAASEAGEARRHFQLTVMD DPPHIEESGETSELSLTPGAHLELLCEARGIPPPNITWHKDGQALRRTEND

SQAGRVLR VDNAGLYTCLAESPAGEVEKSFRVRVQA APPNVVGPRGPRSVVGLAPGQLILECSVEAEPAPEIEWHRGGVLLQ ADAHTHFPEQGRFLK

LQALSTADGGDYSCTARNRAGSTSVAFRVEIHT TAPTIQSGPNTVNVSVNRTTLLPCQTHGVPTPLVSWRKDGIPLHPGSPR RLEFLPEGSLRIHPVL

AQDAGHYLCLASNSAGSDRKGLDLRVFE EPPAIAPGPSNLTLTAYSPASLPCEARGSPKPLVTWWKDGQKLDLRLQQGAYR RLLPSNALFLTAPSPQD

SAQFECVVSNEVGESRRRYQVTVHV VPPTIADDQTHFTVTRMAPVILTCHSTGSPTPAVSWSKAGTQLGARGSGYRILPSG GALEIERALPLHAGRYT

CTARNSAGVARKHMVLTVQA ASPVVKPLPSVVQVVASEEVLLPCEASGIPQPMVIWQKEGLSIPEG GAHMQVLPSGQLRIMHASPEDAGNYFCIAQNS

VGSAMAKTRLVVQV VPPVIENGLPDLSTIEGSHALLPCTAKGSPEPAITWEKDGHLVSGAEGKFTLQPSGELLVKNSE GQDAGTYICTAENAVGRARR

RVHLTILTLPVLTTLPGDRSLRLGDRLWLRCVARGSPTPRIGWTINDQPVTE EGVSEQDGGSTLQRAAVTREDSGTYTCWAENRVGRVQAVSFVHVKE 

EAPVLQGEAFSYLVEPVGGSIQLHCVVRGDPAPDIHWTKDGLPLPISRLHFQLQNGSLTILRTK MDDAGRYQCLAVNEMGTVKKVVTVVLQS SAPVFQ

VEPQDVTVRSGVDVELRCRATGEPVPTIEWLRAGRPLQAGRKLRALPDGSLWLEHVEAGDAGVYECVAHNHLGSVTAKALLAVRG GEPRGSRGSMTGVI

NGQEFGMATLNISVLQQGSSEAPTIWSSISQVPASVG GPLMRVLVVTIAPIYWALARESGEALNGYSLTGGSFQQESQMEFSTG GELLTMTQVARGLD

PDGLLLVDMKINGMIPESLADGDLRVQ - UNI31778 - DFQEHYVQTGPGQLFAGSTQRFLHDSLPASLRCNHSIQYDETRGLQPQLVQHLRASSIS

SAFDPEAEALNFQLTTALQTE - UNI35339 - EENEVGCPEGFEPDVQGAFCVD DKDECSGGPSPCSHTCRNAPGHFSCSCPTGFSLAWDHRNCRD

 DVDECAGNTHLCQEEQRCVNLLGSYNCLASCRPGFRVTADGSNCED DVDECLEQLDECHYNQLCENTPGGHHCGCPRGYRQQGHSLPCLD DINECLQ

LPTPCVYQCQNLQGSYRCLCPPGQTLLRDGRTCIPLERNRQNITIVSHRSPFGPWLRSRVPRPSSSYHTWVSLRPGSGALNSVGRAWCPPGFIRQDGVCA

D DLDECRVRSLCQHACQNTEGSYYCLCPSGYRLLPSGKNCQD DINECEEDGIECGPGQMCFNTRGSFQCVDTPCPTTYRQGSSPG GTCFRRCSQDCS

ASGPSTLQYRLLPLPLGVRAHHDVARLAAFSEAGIPANRTELTVLEPDPRSPFALRQLRAGQGAVYTRRALTRAGLYRLTVRAAAPRHQSVYILLIAVSP

YPY

For any suggestions or comments, please send an email to unitrap@crg.es