Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000055653 (Gpc3)
Chromosomal location
Chr X: 49625610 - 49967127 (-)
Description
glypican 3 Gene [Source:MGI (curated);Acc:Gpc3-001]
RefSeq_dna
NM_016697 
RefSeq_peptide
NP_057906.2 
UniGene
Mm.22515 Mm.470634 
MGI
MGI:104903 
Uniprot/SWISSPROT
Q8CFZ4 
Uniprot/SPTREMBL
B1ATR5 Q3TWB2 Q3TX35 Q9QZF1 
Human Ortholog
ENSG00000147257 (GPC3)
Omim 312870 - SIMPSON-GOLABI-BEHMEL SYNDROME, TYPE 1  
UniTrap UNI9836
Vector Insertion
Chr X: 49782312 - 49935973
Public Clones GST100 (baygenomics) Ex136 (baygenomics) RST238 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 26% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI11227
Vector Insertion
Chr X: 49740840 - 49741412
Public Clones G033G09 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 74% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI8919
Vector Insertion
Chr X: 49668174 - 49718898
Public Clones RST606 (baygenomics) IST14990F11 (tigm)
Private Clones OST64914 (lexicon)
Severity of mutation (?) Insertion after 81% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI9144
Vector Insertion
Chr X: 49626132 - 49668013
Public Clones RST505 (baygenomics) CMHD-GT_132E12-3 (cmhd) (cmhd) CMHD-GT_384F9-3 (cmhd)
CMHD-GT_107B11-3 (cmhd) CMHD-GT_422D3-3 (cmhd) IST15062D7 (tigm) IST15062D6 (tigm)
IST10933H2 (tigm)
Private Clones OST430990 (lexicon) OST361539 (lexicon) OST49604 (lexicon) OST49559 (lexicon)
OST44557 (lexicon) OST44549 (lexicon) OST43760 (lexicon)
Severity of mutation (?) Insertion after 90% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000114857
Sequence
AGGTAGCTGCGAGGAAACTTTTGCGGCGGCTGGGTAGCGGCTCCTCTCTTGCTCTGTCGGGCTACTGCCAGACTTGCTGAGTCTCGGGACCGCTCCGGCT

CTTATTGCCACTCTCTCGTGCTCTCCTCGCTCCCCCAAGAAGCAGGATGGCCGGGACCGTGCGCACCGCGTGCTTGCTGGTGGCGATGCTGCTAGGCTTG

GGCTGCCTGGGACAGGCGCAGCCCCCGCCGCCTCCAGACGCCACCTGTCACCAGGTCCGTTCTTTCTTCCAGAGACTGCAGCCCGGACTCAAATGGGTTC

CAGAAACCCCTGTACCAG GATCAGATTTGCAAGTATGTCTCCCCAAGGGCCCAACATGCTGCTCAAGAAAGATGGAAGAAAAATACCAACTAACAGCAC

GGCTGAACATGGAACAACTGCTCCAGTCTGCGAGTATGGAACTCAAGTTCTTAATTATTCAGAATGCTGCGGTTTTCCAAG - UNI9836 - AGGCCT

TTGAAATTGTTGTTCGCCATGCCAAGAACTACACCAACGCCATGTTCAAGAATAACTACCCCAGCCTGACTCCACAAGCTTTTGAGTTTGTCGGTGAATT

TTTCACAGATGTGTCTCTCTACATCTTGGGTTCTGATATCAACGTGGATGATATGGTCAATGAATTGTTCGACAGCCTCTTTCCAGTCATCTACACCCAG

ATGATGAACCCAGGCCTGCCTGAGTCAGTCTTAGACATCAACGAGTGCCTCCGAGGAGCAAGACGTGACCTGAAAGTATTTGGCAGTTTCCCCAAGCTTA

TTATGACCCAGGTTTCCAAGTCACTGCAAGTCACTCGAATCTTCCTTCAAGCCCTGAATCTCGGAATTGAAGTCATCAACACTACCGACCACCTCAAGTT

TAGTAAGGACTGTGGCCGTATGCTCACCCGAATGTGGTATTGCTCTTACTGCCAGGGACTGATGATGGTTAAGCCTTGCGGTGGTTATTGCAATGTGGTC

ATGCAAGGCTGTATGGCTGGTGTGGTGGAGATCGACAAGTACTGGAGAGAATACATTCTGTCTCTTGAAGAGCTCGTGAATGGCATGTACAGAATCTACG

ACATGGAGAATGTGCTGCTCGGCCTCTTTTCTACCATCCATGATTCCATCCAGTATGTGCAGAAGAACGGAGGCAAGCTGACCACCACC ATTGGCAAGT

TGTGTGCCCACTCCCAGCAACGCCAATATAGATCTGCTTATTACCCTGAAGATCTGTTTATTGACAAGAAGATATTAAAAGTCGCTCATGTCGAACATGA

AGAAACCTTATCCAGCCGAAGAAG - UNI11227 - GGAACTGATTCAGAAACTGAAGTCTTTCATCAACTTCTATAGCGCTTTGCCGGGCTACATCT

GCAGCCATAGCCCCGTGGCCGAAAATGATACCCTGTGCTGGAACGGACAAGAACTTGTGGAGAGGTAATCTTTTGTGAAAGTTAGTTATGTGTAGCAACA

TTTGACAACTAATCATATCCGAAGATTGATTAAATTGCCTTCCTTCATTAACTTCATAGGAAAAATTCTCCACATAACATACCTATAAGCATTTATTTAT

GATGGTCCAAATGCTGTATATAACTTGTAGCTCTCAGAGAATTTGCTCATTTTGAAGCCCATGAAGAACTGCATATTCAGGGATATTTGACAAAGTATAA

AGCATATGGTGAACTTTTCTCCGTCTTCAGTTATTTTCATCTTGTCACTAGGTGGACCATTATTCCTTCTATATGAAACAATCATATTCATGCTGACTGC

TCTCAGTTATTGGGAGTGAACTTTGCATTACACACCATGCTAAGTAATTTGTATATATTAACTTTCTTTGCAACAATCCAATGGAATGAATGCTGAAAAT

GAAGAAAAC
Translation
MAGTVRTACLLVAMLLGLGCLGQAQPPPPPDATCHQVRSFFQRLQPGLKWVPETPVPG GSDLQVCLPKGPTCCSRKMEEKYQLTARLNMEQLLQSASME

LKFLIIQNAAVFQE - UNI9836 - EAFEIVVRHAKNYTNAMFKNNYPSLTPQAFEFVGEFFTDVSLYILGSDINVDDMVNELFDSLFPVIYTQMMNP

GLPESVLDINECLRGARRDLKVFGSFPKLIMTQVSKSLQVTRIFLQALNLGIEVINTTDHLKFSKDCGRMLTRMWYCSYCQGLMMVKPCGGYCNVVMQGC

MAGVVEIDKYWREYILSLEELVNGMYRIYDMENVLLGLFSTIHDSIQYVQKNGGKLTTT IGKLCAHSQQRQYRSAYYPEDLFIDKKILKVAHVEHEETL

SSRRR - UNI11227 - RELIQKLKSFINFYSALPGYICSHSPVAENDTLCWNGQELVER
Transcript ENSMUST00000069360
Sequence
AGGTAGCTGCGAGGAAACTTTTGCGGCGGCTGGGTAGCGGCTCCTCTCTTGCTCTGTCGGGCTACTGCCAGACTTGCTGAGTCTCGGGACCGCTCCGGCT

CTTATTGCCACTCTCTCGTGCTCTCCTCGCTCCCCCAAGAAGCAGGATGGCCGGGACCGTGCGCACCGCGTGCTTGCTGGTGGCGATGCTGCTAGGCTTG

GGCTGCCTGGGACAGGCGCAGCCCCCGCCGCCTCCAGACGCCACCTGTCACCAGGTCCGTTCTTTCTTCCAGAGACTGCAGCCCGGACTCAAATGGGTTC

CAGAAACCCCTGTACCAG GATCAGATTTGCAAGTATGTCTCCCCAAGGGCCCAACATGCTGCTCAAGAAAGATGGAAGAAAAATACCAACTAACAGCAC

GGCTGAACATGGAACAACTGCTCCAGTCTGCGAGTATGGAACTCAAGTTCTTAATTATTCAGAATGCTGCGGTTTTCCAAG - UNI9836 - AGGCCT

TTGAAATTGTTGTTCGCCATGCCAAGAACTACACCAACGCCATGTTCAAGAATAACTACCCCAGCCTGACTCCACAAGCTTTTGAGTTTGTCGGTGAATT

TTTCACAGATGTGTCTCTCTACATCTTGGGTTCTGATATCAACGTGGATGATATGGTCAATGAATTGTTCGACAGCCTCTTTCCAGTCATCTACACCCAG

ATGATGAACCCAGGCCTGCCTGAGTCAGTCTTAGACATCAACGAGTGCCTCCGAGGAGCAAGACGTGACCTGAAAGTATTTGGCAGTTTCCCCAAGCTTA

TTATGACCCAGGTTTCCAAGTCACTGCAAGTCACTCGAATCTTCCTTCAAGCCCTGAATCTCGGAATTGAAGTCATCAACACTACCGACCACCTCAAGTT

TAGTAAGGACTGTGGCCGTATGCTCACCCGAATGTGGTATTGCTCTTACTGCCAGGGACTGATGATGGTTAAGCCTTGCGGTGGTTATTGCAATGTGGTC

ATGCAAGGCTGTATGGCTGGTGTGGTGGAGATCGACAAGTACTGGAGAGAATACATTCTGTCTCTTGAAGAGCTCGTGAATGGCATGTACAGAATCTACG

ACATGGAGAATGTGCTGCTCGGCCTCTTTTCTACCATCCATGATTCCATCCAGTATGTGCAGAAGAACGGAGGCAAGCTGACCACCACC ATTGGCAAGT

TGTGTGCCCACTCCCAGCAACGCCAATATAGATCTGCTTATTACCCTGAAGATCTGTTTATTGACAAGAAGATATTAAAAGTCGCTCATGTCGAACATGA

AGAAACCTTATCCAGCCGAAGAAG - UNI11227 - GGAACTGATTCAGAAACTGAAGTCTTTCATCAACTTCTATAGCGCTTTGCCGGGCTACATCT

GCAGCCATAGCCCCGTGGCCGAAAATGATACCCTGTGCTGGAACGGACAAGAACTTGTGGAGAG - UNI11227 - ATACAGCCAGAAGGCGGCAAGG

AACGGGATGAAGAATCAGTTTAACCTCCATGAGCTGAAAATGAAGGGCCCTGAGCCGGTGGTTAGCCAGATCATTGACAAACTGAAGCACATTAACCAG 

- UNI8919 - CTCCTGAGAACCATGTCTGTGCCCAAGGGTAAAGTTCTGGATAAAAGCCTGGATGAAGAAGGACTTGAAAGTGGAGACTGCGGTGATG

ATGAAGATGAATGCATTGGAAGCTCTGGTGACGGGATGGTGAAAGTGAAGAATCAACTGCGCTTCCTTGCAG - UNI9144 - AACTGGCCTATGATC

TGGATGTGGACGATGCTCCGGGGAACAAGCAGCATGGAAATCAGAAGGACAACGAGATCACCACCTCTCACAGCGTGGGGAACATGCCGTCCCCACTGAA

GATCCTCATCAGTGTGGCCATCTATGTGGCGTGCTTTTTTTTCCTGGTGCACTGACTTGCCAGCGTCCAGTGCCTGTGCTGCCCTGCAGCACCTGTGGTC

CCTACAGAAAGGGAGCCACCTTCTTTTTTTTTTCTTTTTTTTTTTTTTTTTATCTTTTATGCCTCCTCCCACCACCATTAAGTAGGAGACTAACCGCGTG

TTATGTTTTCGAAAATCAAATGGTATCTTTATGAGGATGGTAAATTTTAGTGGTAGGATAGATTGTCTTTTTGCAAAGAAAAAAAAAACCTTCAAGTTGT

GCCAAATTATTTTCTTACATTTGACTGTTGGAACATGGTTGTCATGTTTCCCTCTTTTCTCTTTCTCTGCATGGATTTCTTTGACAAAAAAAAATAAATA

AACATTC
Translation
MAGTVRTACLLVAMLLGLGCLGQAQPPPPPDATCHQVRSFFQRLQPGLKWVPETPVPG GSDLQVCLPKGPTCCSRKMEEKYQLTARLNMEQLLQSASME

LKFLIIQNAAVFQE - UNI9836 - EAFEIVVRHAKNYTNAMFKNNYPSLTPQAFEFVGEFFTDVSLYILGSDINVDDMVNELFDSLFPVIYTQMMNP

GLPESVLDINECLRGARRDLKVFGSFPKLIMTQVSKSLQVTRIFLQALNLGIEVINTTDHLKFSKDCGRMLTRMWYCSYCQGLMMVKPCGGYCNVVMQGC

MAGVVEIDKYWREYILSLEELVNGMYRIYDMENVLLGLFSTIHDSIQYVQKNGGKLTTT IGKLCAHSQQRQYRSAYYPEDLFIDKKILKVAHVEHEETL

SSRRR - UNI11227 - RELIQKLKSFINFYSALPGYICSHSPVAENDTLCWNGQELVER - UNI11227 - RYSQKAARNGMKNQFNLHELKMKG

PEPVVSQIIDKLKHINQ - UNI8919 - LLRTMSVPKGKVLDKSLDEEGLESGDCGDDEDECIGSSGDGMVKVKNQLRFLAE - UNI9144 - ELA

YDLDVDDAPGNKQHGNQKDNEITTSHSVGNMPSPLKILISVAIYVACFFFLVH

For any suggestions or comments, please send an email to unitrap@crg.es