Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000055723 (Rras2)
Chromosomal location
Chr 7: 121190302 - 121261295 (-)
Description
related RAS viral (r-ras) oncogene homolog 2 Gene [Source:MGI Symbol;Acc:MGI:1914172]
RefSeq_dna
NM_025846 
RefSeq_peptide
NP_080122.2 
UniGene
Mm.401109 
MGI
MGI:1914172 
Uniprot/SWISSPROT
P62071 
Uniprot/SPTREMBL
Q9CTF6 
Human Ortholog
ENSG00000133818 (RRAS2)
Omim not available
UniTrap UNI2855
Vector Insertion
Chr 7: 121203934 - 121260909
Public Clones AF0468 (sanger) (sanger) RRU621 (baygenomics) IST13619D5 (tigm) IST15057B3 (tigm)
IST13064C3 (tigm) IST14806G6 (tigm)
Private Clones OST428094 (lexicon) OST361011 (lexicon) OST68765 (lexicon) OST68744 (lexicon)
OST67358 (lexicon) OST57123 (lexicon) OST47398 (lexicon) OST42794 (lexicon)
OST37308 (lexicon)
Severity of mutation (?) Insertion after 17% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI9455
Vector Insertion
Chr 7: 121202544 - 121203845
Public Clones RRD073 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 32% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI8196
Vector Insertion
Chr 7: 121193934 - 121202053
Public Clones RRH305 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 67% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000069449
Sequence
AGACGGCCATTTGTAGCGGTGCCGAAGGCTGCGTTCGGCTGCGCTGCAGATCCGCGAAGAAGAGCGCGCTCCCTGGCCGCTGCGTCCTCTGCCCTGGAGC

CTTCCCGGCTCTCCAGCGTCTCGGGCAACTCCCAGCCGGTCCGAGGGATAGCGCTCCGCGGCCCTCCAGGCCACTCACGGACCCCGCGCGCTCTACCGCC

TGTAACCCAGCCGGCCGCACTCGTCCCCGGAGCCGGGCCTAGGGCGCGCGGCGGCCGGGCTGGGCTCGGGGCGTCCCGATGGCCGCGGCCGGCTGGCGCG

ACGGCTCCGGCCAGGAGAAGTACCGGCTCGTGGTGGTCGGCGGTGGCGGCGTGGGCAAGTCGGCGCTCACCATCCAGTTCATCCAG - UNI2855 - T

CCTATTTTGTGACGGACTATGATCCAACCATTGAAGACTCATACACAAAGCAATGTGTGATCGATGACCGAGCTGCCCGGCTGGACA - UNI9455 - 

TTTTGGATACAGCCGGACAAGAGGAGTTTGGAGCCATGAGAGAGCAATACATGAGGACAGGCGAGGGCTTCCTGTTGGTCTTCTCAGTCACGGATAGAGG

CAG TTTTGAAGAAATCTATAAGTTTCAAAGACAGATTCTCAGAGTAAAGGACCGTGATGAGTTTCCCATGATTTTAATTGGCAATAAAGCTGACCTGGA

CCATCAGAGACAG - UNI8196 - GTAACACAGGAAGAAGGGCAGCAGTTAGCAAGGCAGCTCAAGGTCACATATATGGAGGCATCGGCAAAGATCAG

GATGAATGTAGACCAAGCTTTCCACGAACTTGTCCGGGTTATAAG GAAATTTCAAGAGCAAGAATGCCCTCCTTCACCAGAACCAACCCGGAAAGAAAA

AGACAAGAAAGGCTGCCATTGTGTCATTTTCTAAGAGTCCCTTGAGGTTTAGCTAACAACTGCCAGGGAAGCCCTCATCTCTGCTACCGTTTACATCATC

CGGTACCTTTGTAGCCTTAGACCGATGATCACCGTGTTAGCCTTACACCAAGAAGCTGGCAAATCCTTTATGTGAAGCTAATGTAACGGTCTTACCCAGA

CTTGTGTAAAGGAAACACTAAGGCTGCTTCAGACGTTATCTGATTCCTTTAAAACACATGTCTACACACACAGATGCAGTCTTCAAGGGCTTTTAATAGA

GGTAAACCAAGTTTGGAGCCTGAGCTGTTTGCTAAGCTGAAGTCATAGGTTGGAAAGTAATTTTTAACTTCTGGAATCATGTTGCCTACTGTTACTCTAA

ATAGAAATATAGGGAAGGTTTTTTTTTTGTTGTTGTTGTTTTTTTAAATGTGAATTTTTGCCTATCTTTAAAACTTTGGTTGTCAACTTTCATTAACCTT

AAATACACTGAATGGAATCAACACAAGTGAGACATCTCAGACCTTTCCTGATGCTACGGCTTTTGTTTTTCCAGTGGCCAAAATACCAAAATGCCTGTTG

TATTTATGGATTAAAAACTGCTGATTAAGCCTTTGTTATCATGCTTCCTTCAAGATGACAATATTCTCTGTGGCCAAATGTTTGGACTGGTTCTGCACTT

GGGTGTTTTGGTGAACTCGCTATCTTTTCACAGCCGTGGTAAGGGTAAGAGTGGATGGTTCCTGTCTTGTCTTCCTTCTCAAGTATTCCTGGTTAAGGGA

TTAAAAAAGAAAACCCACACAAGCTAAAGCTGTTTTTGTTTGATGTAATATAAAATATGGAATTGATCTTTCCAAAGTCAGAGATGATTAATGTTTTTGC

TATATACTTTTATACGTTATTTTCTTATCAAACTAGTTAACAAGTATTTTTATATGTTTGTAAGCGGATATGCTTCCACCTTGTGTATATGTAAAGATGA

GTATTTAAGTCTCACTGTTCACTGTTAACTGACAAAGAGACCATGGCTTTTGCTTGCTGGCTTGGTCCTTTTTACATCCACTGGTGGCCAATAATCAGAA

AACCTTCCCAACAGAACGCAACAGGACGAGAGTGCGAAGTCACGTTCAGTGTCCCCGCTAGATATTGACTGTTATATCAAGTATTACGTGTAAAACCTCT

ACTTGACAATTAGTGTAACTGTGGATGGCTTCTGACTTTGTTTTTAACTCTGTGGATTGTGTTTAAGCAATTCGAAGTGCGCTCCTGATTTTGAGACTCA

GTGGTATTGCACAGTGGTCACTTTATTGAATGTGTACAACAGCCCCATGAAGTTTATAAAGTGGACCCTTGTATAGCTTCAGGTGCTAGAATTAAAGTTG

ATCTGTTGTC
Translation
MAAAGWRDGSGQEKYRLVVVGGGGVGKSALTIQFIQ - UNI2855 - SYFVTDYDPTIEDSYTKQCVIDDRAARLDI - UNI9455 - ILDTAGQE

EFGAMREQYMRTGEGFLLVFSVTDRGS SFEEIYKFQRQILRVKDRDEFPMILIGNKADLDHQRQ - UNI8196 - VTQEEGQQLARQLKVTYMEASA

KIRMNVDQAFHELVRVIR RKFQEQECPPSPEPTRKEKDKKGCHCVIF

For any suggestions or comments, please send an email to unitrap@crg.es