Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000055762 (Eef1d)
Chromosomal location
Chr 15: 75725230 - 75739749 (-)
eukaryotic translation elongation factor 1 delta (guanine nucleotide exchange protein) Gene [Source:MGI (curated);Acc:Eef1d-006]
NM_023240 NM_029663 
NP_083939.1 NP_075729.2 
Q9CVV2 Q8BW50 Q91VK2 Q68FG5 Q80T06 
Human Ortholog
ENSG00000104529 (EEF1D)
Omim not available
UniTrap UNI7339
Vector Insertion
Chr 15: 75739674 - 75739721
Public Clones XI253 (baygenomics) XI444 (baygenomics) RRU103 (baygenomics) XI445 (baygenomics)
P141C11 (ggtc) (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI29484
Vector Insertion
Chr 15: 75736315 - 75739721
Public Clones (sanger) P141C11 (ggtc) PST22371-NR (escells)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI37907
Vector Insertion
Chr 15: 75733108 - 75736331
Public Clones (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI11051
Vector Insertion
Chr 15: 75731561 - 75731686
Public Clones Q998F10 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI22421
Vector Insertion
Chr 15: 75731561 - 75731686
Public Clones not available
Private Clones OST297521 (lexicon) OST190991 (lexicon) OST128723 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI22436
Vector Insertion
Chr 15: 75731120 - 75731193
Public Clones not available
Private Clones OST297075 (lexicon)
Severity of mutation (?) Insertion after 15% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI29500
Vector Insertion
Chr 15: 75731120 - 75731683
Public Clones P133F10 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 15% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI29461
Vector Insertion
Chr 15: 75728535 - 75731193
Public Clones P151B02 (ggtc) P134E05 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 15% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI29498
Vector Insertion
Chr 15: 75727655 - 75731193
Public Clones P134E05 (ggtc) PST20496-NR (escells)
Private Clones not available
Severity of mutation (?) Insertion after 15% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI24891
Vector Insertion
Chr 15: 75727249 - 75727350
Public Clones not available
Private Clones OST202101 (lexicon)
Severity of mutation (?) Insertion after 15% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI4804
Vector Insertion
Chr 15: 75726161 - 75726357
Public Clones AS0013 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 70% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000073802















GCCAGAGAGAACATCCAGAAATCCTTGGCTGGA - UNI22436 - - UNI24891 - - UNI29461 - - UNI29498 - - UNI29500 - A










HGSHVACHHVTWGIWVNKSCFD - UNI11051 - - UNI22421 -  - UNI11051 - - UNI22421 - - UNI22436 - - UNI29461 

- - UNI29498 - - UNI29500 -  - UNI22436 - - UNI24891 - - UNI29461 - - UNI29498 - - UNI29500 -  - UNI

24891 -   - UNI4804 -  - UNI4804 - 
Transcript ENSMUST00000055220






























51 - - UNI22421 - - UNI22436 - - UNI29461 - - UNI29498 - - UNI29500 - ENGASVILRDIARARENIQKSLAGVSTRGP

Transcript ENSMUST00000109972


















 - UNI7339 - - UNI11051 - - UNI22421 - - UNI29484 - - UNI29500 - MATNFLAHEKIWFDKFKYDDAERRFYEQMNGPVTS

GSRQ - UNI11051 - - UNI22421 - - UNI22436 - - UNI24891 - - UNI29461 - - UNI29498 - - UNI29500 - SSGP



Transcript ENSMUST00000089680











 - UNI7339 - - UNI11051 - - UNI22421 - - UNI29484 - - UNI29500 - MATNFLAHEKIWFDKFKYDDAERRFYEQMNGPVTS

GSRQ - UNI11051 - - UNI22421 - - UNI22436 - - UNI29461 - - UNI29498 - - UNI29500 - LKVMLPNSPEALGQATP



Transcript ENSMUST00000116440











51 - - UNI22421 - - UNI22436 - - UNI24891 - - UNI29461 - - UNI29498 - - UNI29500 - SSGPGASSGPGGDHSEL



Transcript ENSMUST00000089681














GCTCCCGCCAG - UNI11051 - - UNI22421 - - UNI22436 - - UNI29461 - - UNI29498 - - UNI29500 - GAGAATGGTG














- UNI22421 - - UNI22436 - - UNI29461 - - UNI29498 - - UNI29500 - ENGASVILRDIARARENIQKSLAG - UNI22436

 - - UNI24891 - - UNI29461 - - UNI29498 - - UNI29500 - SSGPGASSGPGGDHSELIVRITSLEVENQNLRGV - UNI24891



Transcript ENSMUST00000109976












51 - - UNI22421 - - UNI22436 - - UNI29461 - - UNI29498 - - UNI29500 - LKVMLPNSPEALGQATPGT - UNI24891



Transcript ENSMUST00000023235













51 - - UNI22421 - - UNI22436 - - UNI29461 - - UNI29498 - - UNI29500 - ENGASVILRDIARARENIQKSLAG - UNI

22436 - - UNI24891 - - UNI29461 - - UNI29498 - - UNI29500 - SSGPGASSGPGGDHSELIVRITSLEVENQNLRGV - UNI



Transcript ENSMUST00000109975














CCAGAGAGAACATCCAGAAATCCTTGGCTGGA - UNI22436 - - UNI24891 - - UNI29461 - - UNI29498 - - UNI29500 - AG













 UNI29498 - - UNI29500 - ENGASVILRDIARARENIQKSLAG - UNI22436 - - UNI24891 - - UNI29461 - - UNI29498 




For any suggestions or comments, please send an email to