Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000055762 (Eef1d)
Chromosomal location
Chr 15: 75725230 - 75739749 (-)
Description
eukaryotic translation elongation factor 1 delta (guanine nucleotide exchange protein) Gene [Source:MGI (curated);Acc:Eef1d-006]
RefSeq_dna
NM_023240 NM_029663 
RefSeq_peptide
NP_083939.1 NP_075729.2 
UniGene
Mm.258927 
MGI
MGI:1913906 
Uniprot/SWISSPROT
P57776 
Uniprot/SPTREMBL
Q9CVV2 Q8BW50 Q91VK2 Q68FG5 Q80T06 
Human Ortholog
ENSG00000104529 (EEF1D)
Omim not available
UniTrap UNI7339
Vector Insertion
Chr 15: 75739674 - 75739721
Public Clones RRU103 (baygenomics) XI445 (baygenomics) XI253 (baygenomics) XI444 (baygenomics)
P141C11 (ggtc) (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI29484
Vector Insertion
Chr 15: 75736315 - 75739721
Public Clones (sanger) P141C11 (ggtc) PST22371-NR (escells)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI37907
Vector Insertion
Chr 15: 75733108 - 75736331
Public Clones (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI11051
Vector Insertion
Chr 15: 75731561 - 75731686
Public Clones Q998F10 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI22421
Vector Insertion
Chr 15: 75731561 - 75731686
Public Clones not available
Private Clones OST297521 (lexicon) OST190991 (lexicon) OST128723 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI22436
Vector Insertion
Chr 15: 75731120 - 75731193
Public Clones not available
Private Clones OST297075 (lexicon)
Severity of mutation (?) Insertion after 15% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI29500
Vector Insertion
Chr 15: 75731120 - 75731683
Public Clones P133F10 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 15% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI29461
Vector Insertion
Chr 15: 75728535 - 75731193
Public Clones P151B02 (ggtc) P134E05 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 15% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI29498
Vector Insertion
Chr 15: 75727655 - 75731193
Public Clones P134E05 (ggtc) PST20496-NR (escells)
Private Clones not available
Severity of mutation (?) Insertion after 15% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI24891
Vector Insertion
Chr 15: 75727249 - 75727350
Public Clones not available
Private Clones OST202101 (lexicon)
Severity of mutation (?) Insertion after 15% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI4804
Vector Insertion
Chr 15: 75726161 - 75726357
Public Clones AS0013 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 70% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000073802
Sequence
TGAGCTCGCAGTTCCAGGTTTTGGTTGCTGCGTCCTTGGCTGGCGT - UNI7339 - - UNI29484 - GAGGCCAAAGCAAAA - UNI29484 -

 ATGAGGAGTGGGAAGGCCTCTTGTGCACTGGAGACCGTCTGGGAGGACAGGCACAAGTATGAGGGAGCCGAGCGGCGCTTCCACGAGCAGGAGGCCACA

CAAGTCGTCGCCGCCGCCGCCACTGCCGCCGCCACTGCCTCCGCCTCTGTCCAGCAGCTCCTGGACGAAGTGCCAGCTGTGAACGGGCCCAGCCAGGAGG

ACACAGAGGACACTGAGGAGGCAGAGGCCCCAAACACCAGCAGCAGGAGTGATCCCGGGAAGAGCCACGAGTGCAAGAAGCCGATACAGAAAAAGAGGAA

GCGCTCCCCGAAAAGTTGGCTGGGCCAGGCAGACCTGGCCCTTGTGGGCCTCTCGGCTGACCACGTATGGTTAGACAAGCCACTCTTCGACCAGGCAGAA

AGCTCCTACCGTCAGAGGCTGGCAGATGTAGCTGCCCAGGCAGCCCAGCCGCCTGCTCTGGCCCCTCGGGGGCCCTGTACACATGGAAGCCATGTGGCAT

GCCACCATGTAACCTGGGGGATCTGGGTCAACAAGTCTTGCTTTGATCAAGCCGAGCGGGCTTTTGTGGAGTGGTCTCAGTCCTTGCTGCTGGCTGCAGA

GGGGAGCCATAGGCAGGGGACTCCTGACACAGGCCAGCAGGCTGTCACTCCTGACCTGGCCTTGGCCTGCCAGCCTTGCCCACCAGCCAATGGCCAGCCT

CCTCTGGGCAGCCTGCAGGCACTGGTGCGGGAGGTATGGCTGGAGAAGCCCCGGTACGATGCCGCTGAGAGGGGCTTCTATGAGGCCCTGTTTGATGGTC

ATCCCCCAGGGAAAGTGCGCCTGCAGGAGCGAGCCAGTCAGGCAGAGGGTACCCGGAGGGGCCGCAGAGACCATCGGAGCTGCAATAACGTAGGAAACAA

GAGAGCTGGGTCAAAACGGGCCAACGGGGAGGCTCCTCCTGCTTTTCCCTACTGGTACTTCCTACACAAGGACGCAGAGGCCCCCTGGCTCAGCAAGCCT

ACCTACGACAGCGCTGAGTGCCGCCACCATGCCGTTGAGGCCCTGCGCATAGCCTGGCGCCTAGAAGCTGCCTCCCTGGCTCACCGACCCACACCCCGTT

CTGGCCCATCCATGTCCAGCCTGAGACCCAA - UNI11051 - - UNI22421 - CAGAAAAATGGCTACAAACTTTCTAGCGCATGAGAAGATCTG

GTTTGACAAGTTTAAATATGATGATGCAGAAAGGAGATTCTATGAGCAGATGAACGGGCCTGTGACCTCCGGCTCCCGCCAG - UNI11051 - - UN

I22421 - - UNI22436 - - UNI29461 - - UNI29498 - - UNI29500 - GAGAATGGTGCCAGCGTGATCCTCCGAGACATTGCAAGA

GCCAGAGAGAACATCCAGAAATCCTTGGCTGGA - UNI22436 - - UNI24891 - - UNI29461 - - UNI29498 - - UNI29500 - A

GCTCAGGCCCTGGAGCCTCCAGTGGACCTGGTGGAGACCACAGTGAGCTCATTGTGAGGATTACCAGTCTGGAAGTGGAGAACCAGAACCTTCGAGGCG 

- UNI24891 - TGGTGCAAGATTTGCAGCAGGCCATTTCCAAGTTGGAGGCCCGGCTGAGCTCTCTAGAGAAGAGTTCACCTACTCCCCGAGCCACGG

CCCCACAGACCCAA CATGTCTCTCCTATGCGTCAAGTGGAGCCCCCAACCAAGAAAGGAGCCACACCAGCAGAGGACGATGAGGACAAGGACATTGACC

TGTTCGGCAGTGACGAGGAGGAAGAAGATAAGGAGGCTGCCCGACTACGGGAGGAGAGGCTACGCCAGTACGCAGAGAAGAAGGCCAAGAAGCCCACACT

GGTGGCCAAATCCTCCATCCTTTTGGATGTTAAACCT - UNI4804 - TGGGATGATGAGACTGACATGGCCCAGCTAGAGACTTGTGTGCGTTCCAT

CCAATTGGACGGGCTGGTTTGGGGGGCCTCCAAGCTTGTGCCTGTTGGCTATGGCATCCGGAAGCTGCAGATCCAGTGTGTGGTGGAGGATGACAAAGTG

GGCACCGACTTGCTCGAGGAGGAGATCACCAAATTTGAGGAGCAT - UNI4804 - GTGCAGAGTGTCGACATCGCAGCTTTCAACAAGATCTGAATG

TCCGAGAGAGTGTGGTTTCATGTGTGTGAGGACCTGCTGAGATTAAAGACTGAGACTCTG
Translation
 - UNI7339 - - UNI29484 -  - UNI29484 - MRSGKASCALETVWEDRHKYEGAERRFHEQEATQVVAAAATAAATASASVQQLLDEVPAV

NGPSQEDTEDTEEAEAPNTSSRSDPGKSHECKKPIQKKRKRSPKSWLGQADLALVGLSADHVWLDKPLFDQAESSYRQRLADVAAQAAQPPALAPRGPCT

HGSHVACHHVTWGIWVNKSCFD - UNI11051 - - UNI22421 -  - UNI11051 - - UNI22421 - - UNI22436 - - UNI29461 

- - UNI29498 - - UNI29500 -  - UNI22436 - - UNI24891 - - UNI29461 - - UNI29498 - - UNI29500 -  - UNI

24891 -   - UNI4804 -  - UNI4804 - 
Transcript ENSMUST00000055220
Sequence
GCGGGCGCCCTCCCTCTCCTTTGCAGTCCTGAGCTCGCAGTTCCAGGTTTTGGTTGCTGCGTCCTTGGCTGGCGT - UNI7339 - - UNI11051 -

 - UNI22421 - - UNI29484 - CAGAAAAATGGCTACAAACTTTCTAGCGCATGAGAAGATCTGGTTTGACAAGTTTAAATATGATGATGCAGAA

AGGAGATTCTATGAGCAGATGAACGGGCCTGTGACCTCCGGCTCCCGCCAG - UNI11051 - - UNI22421 - - UNI22436 - - UNI2946

1 - - UNI29498 - - UNI29500 - GAGAATGGTGCCAGCGTGATCCTCCGAGACATTGCAAGAGCCAGAGAGAACATCCAGAAATCCTTGGCTG

GAGTGAGTACCCGCGGCCCACGTACTCATGGGCTCGTGCTCGGCCAAACAGCATGTCTGATTGGTTTTTTGAGGTTTTTTTTTTCCCCCTTTAAAAAAGC

AACAACAAAAACCTTTAGTACTGCTGACTATTTTGGCCTTTGGAGCAAGTTAGGGCACAAGGTGTGATGCTGTGCCCTTGGGATATGAGTGCTGAAGCCT

CCGTGCCCACACTGTCATGGAAAATGATCTTGCTTTCTCGACTTTTCCATGTGTCTCTCTCATGCATAGTGGAGCTCACTCTTAGTTCGTCAGTGCCTGC

CGGGGGCTGCCTGGGCTAATCAGTGTCATTCTGCAGGGTGTGAATTGTTGCCACATGCCTTGGAAGTCTGTTCCTTCCTGCTTGCTTGCTCGCTTGCTGA

AGTAGCTTGTGCCTCCTATCCCTTAAACCACTCTATTCCTCTTGATTAGGTGGGGCCCTTCATGGAAAGAGGATAATTATTTGGTTCGGTATGCTAGTCA

GCATCATCTTAGACTAAGTCCTAGGGAGGGACCCTGTGGCCTGCAAGGCCAGATATGCTCCATCTGGACTCCTTGATGAAGCTGCGCCCTTCAGATAGCA

GGCAGACCTGCTCTGACTCCCTTACTCCAAAGAAGTCTGGACCTCGCTCTGTCTGGAGAGGGTTATGTGTACTGGAACAGCCTTTCTGATGGCTCTCTAA

TGGGTTCCCACAACCTTACTGTTTAAAACTGCAAATTTATCATCAAAATGATCCTGAAGGTTGGAAGTTGAAATGGGGCCAAAGACCAGTGGAGGCTTCC

GAGGCTCCGAGCATCTGCCTGTTTGCGTTTCTTGGGCCAGTGCATGTCCCTTGGCACCTCACCCTGTCAGCCTCTCCTTACCCCTGTGGCCTTCCTACAT

CCCGCCATCACAAGGATTCTTGGGACTGAATCAAGTTCAGGTTCTTGTTTTGTCTTCTGAACTGTCCGTTTTTGAAAGTATGCTATTCAGCAGGTTCATA

GGCAGCAGGCACTCACTCCCACTCAAGAAAGAGAAATGTGGAGGGGATTCCAGACAGCTTCAGCATCCAGCCAGGCCTCCTGAATGGCTCCTTTGTGGTT

CATTTGGCCACTGGGAGACAGTTTTCACCAAATAGCACAGTTTAGGTTGGGATTTTAACAACCTTCCTGCTTGTAAAAGAGATCTTTAGTCTTTAAGAAA

ATGTGGGGATTTTTTTGTTTTAATATTTCATCTTGACTCCCCTTTTTTTGGGGGGGGGGTCTAAATTAGTGGTGTTTTTGCTAGTAACATTTCAAAAACC

CTGAAGGTATACTTTGTCACAGCAATCTGTGCCATCGCAGGAGATGTCTCTGGGTGGTTTTGGTCCCATCTCATTTCTTGGCTTTTGTCAAGATGACTAT

GGAAATTCATCTATGATATACCTGCTCTCTGACCTTCCACTCTTCCCAAGGCAGCCATTGCTGCCCTCCACATTTCGCTCTCCTGACTTTTATCTTTTTC

TTTGCACTCTATGAGGAACTACATATATTAAAGAATCTCCCCCAGCCATCTGGCCCTGGCTTCTTTCTGCTCCAGTTTTTCCCCCCTGAGTTTCTCTTCT

TTCTCCCCTAAGTAGTAAAAAGAAAGCATACTCCACCTTCCACATGTAGAAATATCAGCTTCCTGGCCAGGTTACAGTCACAGCCCTGGGGAAAGCTAAG

GCTAGAGGACCGCCACACGTTTGAGGTCTGCACTGTAGAAGGTGTTTTGAGAGGAAAGAAAAAAATCTCAGTTGAAGATCTCATGTCCTGGAGACAGAGG

GACTAAACTCCCTACGGTGCTTTCTGCCTTGGAAGGTCTGTGCCCACTGCCCTCTTTCTTCTTCACATCTTTAGGAATTTGTCCCAGCAGCACCCCACAC

AGCTAGTGAACTTAAACTGACACAAATCTGCCATCTTACAGTTCTGGGGGGTCAGATCTTCAAAGGCATCTTGTAGAGCAGGACCAAGGTGCCCGTCCAC

GGGGTCCTTCAGAAGTCTGGAAGAAATCCGCTCCATCTTTGGTACCTGTCTGATCGTCCCTGCCTCCCTTTGTCTGGTTCCTGCTGCTGTGCACAGAGCA

TCTGGAACTCAGCCTTCCTAACGCTGCGACCTTTAACACAGTTTATCACGGCCTGGTGACTTCTCCCAGCTGTAACACTGGTTTCATCGCTACTTCATAA

CTGTAATTTTACTACTGTTATGAATCTAATGTAAATCTTTGTTTTCTAACGGTCGTAGTTGTTCAACCCCATAAAGGGGTTAAGACCTACAGGTTGAGAA

TTACTGGTCGAGGGCCTTAGTTCACCTATTAAATCTGCCTTACTGTGTGAACTAACATGCTAAGCTTTGGAGAGTACAGCCATTTCTAGGGCACTATTCT

ATAGGTAGTCAAAAAGTGCATAGCCTTTTTAAAAGGCTGCGCACAAACACCTGACCCCTTCTTGGTCCTACCTGACTTCTGTTCTCATCCTACCATTCCC

AAGTCCAAACTCGTGATCCCCGTGGTTTGGGGTAAAAGATTTGTGCACTTGGCCAGGCACATTGAGTTCAGCCCCCCCCCTCCCCCC
Translation
 - UNI7339 - - UNI11051 - - UNI22421 - - UNI29484 - MATNFLAHEKIWFDKFKYDDAERRFYEQMNGPVTSGSRQ - UNI110

51 - - UNI22421 - - UNI22436 - - UNI29461 - - UNI29498 - - UNI29500 - ENGASVILRDIARARENIQKSLAGVSTRGP

RTHGLVLGQTACLIGFLRFFFSPFKKATTKTFSTADYFGLWSKLGHKV
Transcript ENSMUST00000109972
Sequence
GCGGGCGCCCTCCCTCTCCTTTGCAGTCCTGAGCTCGCAGTTCCAGGTTTTGGTTGCTGCGTCCTTGGCTGGCGT - UNI7339 - - UNI11051 -

 - UNI22421 - - UNI29484 - - UNI29500 - AAAAATGGCTACAAACTTTCTAGCGCATGAGAAGATCTGGTTTGACAAGTTTAAATATGA

TGATGCAGAAAGGAGATTCTATGAGCAGATGAACGGGCCTGTGACCTCCGGCTCCCGCCAG - UNI11051 - - UNI22421 - - UNI22436 -

 - UNI24891 - - UNI29461 - - UNI29498 - - UNI29500 - AGCTCAGGCCCTGGAGCCTCCAGTGGACCTGGTGGAGACCACAGTGA

GCTCATTGTGAGGATTACCAGTCTGGAAGTGGAGAACCAGAACCTTCGAGGCG - UNI24891 - TGGTGCAAGATTTGCAGCAGGCCATTTCCAAGT

TGGAGGCCCGGCTGAGCTCTCTAGAGAAGAGTTCACCTACTCCCCGAGCCACGGCCCCACAGACCCAA CATGTCTCTCCTATGCGTCAAGTGGAGCCCC

CAACCAAGAAAGGAGCCACACCAGCAGAGGACGATGAGGACAAGGACATTGACCTGTTCGGCAGTGACGAGGAGGAAGAAGATAAGGAGGCTGCCCGACT

ACGGGAGGAGAGGCTACGCCAGTACGCAGAGAAGAAGGCCAAGAAGCCCACACTGGTGGCCAAATCCTCCATCCTTTTGGATGTTAAACCT - UNI480

4 - TGGGATGATGAGACTGACATGGCCCAGCTAGAGACTTGTGTGCGTTCCATCCAATTGGACGGGCTGGTTTGGGGGGCCTCCAAGCTTGTGCCTGTT

GGCTATGGCATCCGGAAGCTGCAGATCCAGTGTGTGGTGGAGGATGACAAAGTGGGCACCGACTTGCTCGAGGAGGAGATCACCAAATTTGAGGAGCAT 

- UNI4804 - GTGCAGAGTGTCGACATCGCAGCTTTCAACAAGATCTGAATGTCCGAGAGAGTGTGGTTTCATGTGTGTGAGGACCTGCTGAGATTAA

AGACTGAGACTCTGCACTCCGCCTCTTGTGTTACTTGGTGTACAGCGCTCTGTGGGCTCTGGCTCATACTTGTCCCAGAAACAATCTATTAGGTCCACAT

TTGTCCACCGTGTCTCTCCTGTCCCTGCTGTTGTCACCGTGTACACCTAGACCCAGTCTAACACTCCTCTTCACACTCCTTACCTCTGGAGGGATACATC

CTCTTTATATATTCTGGGATGGTTAGAATATGGACAGCCAGCTGTACTGTATGGAATTTTGTCTGCCCGCTCCCCTAAAACCCCTTGTCAGTGCTTGGGT

ATTGGTGGTATTGGGACGATAGTGCTCGTGAAATCCTGCGAACATCTAAGTTGAGAAAGTGTACCAAGTGTGGCTGATTCCTGTCAGTGTTGTTCATCAT

GGCCCCTAGTCACCAGGAAACAATGTAGCCCTCCCCCTCAAAAGTTTTAGACTTTTCCTGTGGGACCTGAACAAAAAACTGTCACCTGGGCAAGGATGAC

TTCGCAGTTAAGAACACTATTCTGGAAGATGGGGCTCATTCCCAGCAACCACATGGAAACTTACAAACCAGCTGTAACTCCAGTTCCTGGATACCTGATA

CCCTCTTCTGGCCTCTGGGCATGCATATCTGCCTGCAGTACAAAAACACCTACACTTTTTTTTTTTTTTTGAGAATAAATTTTGCTGTATATCCTTGTCA

GTTT
Translation
 - UNI7339 - - UNI11051 - - UNI22421 - - UNI29484 - - UNI29500 - MATNFLAHEKIWFDKFKYDDAERRFYEQMNGPVTS

GSRQ - UNI11051 - - UNI22421 - - UNI22436 - - UNI24891 - - UNI29461 - - UNI29498 - - UNI29500 - SSGP

GASSGPGGDHSELIVRITSLEVENQNLRGV - UNI24891 - VVQDLQQAISKLEARLSSLEKSSPTPRATAPQTQ HVSPMRQVEPPTKKGATPAED

DEDKDIDLFGSDEEEEDKEAARLREERLRQYAEKKAKKPTLVAKSSILLDVKP - UNI4804 - WDDETDMAQLETCVRSIQLDGLVWGASKLVPVGY

GIRKLQIQCVVEDDKVGTDLLEEEITKFEEH - UNI4804 - VQSVDIAAFNKI
Transcript ENSMUST00000089680
Sequence
GCGGGCGCCCTCCCTCTCCTTTGCAGTCCTGAGCTCGCAGTTCCAGGTTTTGGTTGCTGCGTCCTTGGCTGGCGT - UNI7339 - - UNI11051 -

 - UNI22421 - - UNI29484 - - UNI29500 - AAAAATGGCTACAAACTTTCTAGCGCATGAGAAGATCTGGTTTGACAAGTTTAAATATGA

TGATGCAGAAAGGAGATTCTATGAGCAGATGAACGGGCCTGTGACCTCCGGCTCCCGCCAG - UNI11051 - - UNI22421 - - UNI22436 -

 - UNI29461 - - UNI29498 - - UNI29500 - CTCAAGGTGATGCTGCCCAACTCCCCTGAGGCCCTGGGCCAGGCCACCCCTGGGACT - 

UNI24891 - - UNI29498 - AGCTCAGGCCCTGGAGCCTCCAGTGGACCTGGTGGAGACCACAGTGAGCTCATTGTGAGGATTACCAGTCTGGAAG

TGGAGAACCAGAACCTTCGAGGCG - UNI24891 - TGGTGCAAGATTTGCAGCAGGCCATTTCCAAGTTGGAGGCCCGGCTGAGCTCTCTAGAGAAG

AGTTCACCTACTCCCCGAGCCACGGCCCCACAGACCCAA CATGTCTCTCCTATGCGTCAAGTGGAGCCCCCAACCAAGAAAGGAGCCACACCAGCAGAG

GACGATGAGGACAAGGACATTGACCTGTTCGGCAGTGACGAGGAGGAAGAAGATAAGGAGGCTGCCCGACTACGGGAGGAGAGGCTACGCCAGTACGCAG

AGAAGAAGGCCAAGAAGCCCACACTGGTGGCCAAATCCTCCATCCTTTTGGATGTTAAACCT - UNI4804 - TGGGATGATGAGACTGACATGGCCC

AGCTAGAGACTTGTGTGCGTTCCATCCAATTGGACGGGCTGGTTTGGGGGGCCTCCAAGCTTGTGCCTGTTGGCTATGGCATCCGGAAGCTGCAGATCCA

GTGTGTGGTGGAGGATGACAAAGTGGGCACCGACTTGCTCGAGGAGGAGATCACCAAATTTGAGGAGCAT - UNI4804 - GTGCAGAGTGTCGACAT

CGCAGCTTTCAACAAGATCTGAATGTCCGAGAGAGTGTGGTTTCATGTGTGTGAGGACCTGCTGAGATTAAAGACTGAGACTCTG
Translation
 - UNI7339 - - UNI11051 - - UNI22421 - - UNI29484 - - UNI29500 - MATNFLAHEKIWFDKFKYDDAERRFYEQMNGPVTS

GSRQ - UNI11051 - - UNI22421 - - UNI22436 - - UNI29461 - - UNI29498 - - UNI29500 - LKVMLPNSPEALGQATP

GT - UNI24891 - - UNI29498 - SSGPGASSGPGGDHSELIVRITSLEVENQNLRGV - UNI24891 - VVQDLQQAISKLEARLSSLEKSS

PTPRATAPQTQ HVSPMRQVEPPTKKGATPAEDDEDKDIDLFGSDEEEEDKEAARLREERLRQYAEKKAKKPTLVAKSSILLDVKP - UNI4804 - W

DDETDMAQLETCVRSIQLDGLVWGASKLVPVGYGIRKLQIQCVVEDDKVGTDLLEEEITKFEEH - UNI4804 - VQSVDIAAFNKI
Transcript ENSMUST00000116440
Sequence
CTCTCCTTTGCAGTCCTGAGCTCGCAGTTCCAGGTTTTGGTTGCTGCGTCCTTGGCTGGCGT - UNI7339 - - UNI11051 - - UNI22421 -

 - UNI29484 - CAGAAAAATGGCTACAAACTTTCTAGCGCATGAGAAGATCTGGTTTGACAAGTTTAAATATGATGATGCAGAAAGGAGATTCTATG

AGCAGATGAACGGGCCTGTGACCTCCGGCTCCCGCCAG - UNI11051 - - UNI22421 - - UNI22436 - - UNI24891 - - UNI2946

1 - - UNI29498 - - UNI29500 - AGCTCAGGCCCTGGAGCCTCCAGTGGACCTGGTGGAGACCACAGTGAGCTCATTGTGAGGATTACCAGTC

TGGAAGTGGAGAACCAGAACCTTCGAGGCG - UNI24891 - TGGTGCAAGATTTGCAGCAGGCCATTTCCAAGTTGGAGGCCCGGCTGAGCTCTCTA

GAGAAGAGTTCACCTACTCCCCGAGCCACGGCCCCACAGACCCAA CATGTCTCTCCTATGCGTCAAGTGGAGCCCCCAACCAAGAAAGGAGCCACACCA

GCAGAGGACGATGAGGACAAGGACATTGACCTGTTCGGCAGTGACGAGGAGGAAGAAGATAAGGAGGCTGCCCGACTACGGGAGGAGAGGCTACGCCAGT

ACGCAGAGAAGAAGGCCAAGAAGCCCACACTGGTGGCCAAATCCTCCATCCTTTTGGATGTTAAACCT - UNI4804 - TGGGATGATGAGACTGACA

TGGCCCAGCTAGAGACTTGTGTGCGTTCCATCCAATTGGACGGGCTGGTTTGGGGGGCCTCCAAGCTTGTGCCTGTTGGCTATGGCATCCGGAAGCTGCA

GATCCAGTGTGTGGTGGAGGATGACAAAGTGGGCACCGACTTGCTCGAGGAGGAGATCACCAAATTTGAGGAGCAT - UNI4804 - GTGCAGAGTGT

CGACATCGCAGCTTTCAACAAGATCTGAATGTCCGAGAGAGTGTGGTTTCATGTGTGTGAGGACCTGCTGAGATTAAAGACTGAGACTC
Translation
 - UNI7339 - - UNI11051 - - UNI22421 - - UNI29484 - MATNFLAHEKIWFDKFKYDDAERRFYEQMNGPVTSGSRQ - UNI110

51 - - UNI22421 - - UNI22436 - - UNI24891 - - UNI29461 - - UNI29498 - - UNI29500 - SSGPGASSGPGGDHSEL

IVRITSLEVENQNLRGV - UNI24891 - VVQDLQQAISKLEARLSSLEKSSPTPRATAPQTQ HVSPMRQVEPPTKKGATPAEDDEDKDIDLFGSDE

EEEDKEAARLREERLRQYAEKKAKKPTLVAKSSILLDVKP - UNI4804 - WDDETDMAQLETCVRSIQLDGLVWGASKLVPVGYGIRKLQIQCVVED

DKVGTDLLEEEITKFEEH - UNI4804 - VQSVDIAAFNKI
Transcript ENSMUST00000089681
Sequence
GCGGGCGCCCTCCCTCTCCTTTGCAGTCCTGAGCTCGCAGTTCCAGGTTTTGGTTGCTGCGTCCTTGGCTGGCGT - UNI7339 - - UNI29484 -

 GAGGCCAAAGCAAAA - UNI29484 - ATGAGGAGTGGGAAGGCCTCTTGTGCACTGGAGACCGTCTGGGAGGACAGGCACAAGTATGAGGGAGCCG

AGCGGCGCTTCCACGAGCAGGAGGCCACACAAGTCGTCGCCGCCGCCGCCACTGCCGCCGCCACTGCCTCCGCCTCTGTCCAGCAGCTCCTGGACGAAGT

GCCAGCTGTGAACGGGCCCAGCCAGGAGGACACAGAGGACACTGAGGAGGCAGAGGCCCCAAACACCAGCAGCAGGAGTGATCCCGGGAAGAGCCACGAG

TGCAAGAAGCCGATACAGAAAAAGAGGAAGCGCTCCCCGAAAAGTTGGCTGGGCCAGGCAGACCTGGCCCTTGTGGGCCTCTCGGCTGACCACGTATGGT

TAGACAAGCCACTCTTCGACCAGGCAGAAAGCTCCTACCGTCAGAGGCTGGCAGATGTAGCTGCCCAGGCAGCCCAGCCGCCTGCTCTGGCCCCTCGGGG

GCCCTGTACACATGGAAGCCATGTGGCATGCCACCATGTAACCTGGGGGATCTGGGTCAACAAGTCTTGCTTTGATCAAGCCGAGCGGGCTTTTGTGGAG

TGGTCTCAGTCCTTGCTGCTGGCTGCAGAGGGGAGCCATAGGCAGGGGACTCCTGACACAGGCCAGCAGGCTGTCACTCCTGACCTGGCCTTGGCCTGCC

AGCCTTGCCCACCAGCCAATGGCCAGCCTCCTCTGGGCAGCCTGCAGGCACTGGTGCGGGAGGTATGGCTGGAGAAGCCCCGGTACGATGCCGCTGAGAG

GGGCTTCTATGAGGCCCTGTTTGATGGTCATCCCCCAGGGAAAGTGCGCCTGCAGGAGCGAGCCAGTCAGGCAGAGGGTACCCGGAGGGGCCGCAGAGAC

CATCGGAGCTGCAATAACGTAGGAAACAAGAGAGCTGGGTCAAAACGGGCCAACGGGGAGGCTCCTCCTGCTTTTCCCTACTGGTACTTCCTACACAAGG

ACGCAGAGGCCCCCTGGCTCAGCAAGCCTACCTACGACAGCGCTGAGTGCCGCCACCATGCCGTTGAGGCCCTGCGCATAGCCTGGCGCCTAGAAGCTGC

CTCCCTGGCTCACCGACCCACACCCCGTTCTGGCCCATCCATGTCCAGCCTGAGACCCAA - UNI11051 - - UNI22421 - CAGAAAAATGGCT

ACAAACTTTCTAGCGCATGAGAAGATCTGGTTTGACAAGTTTAAATATGATGATGCAGAAAGGAGATTCTATGAGCAGATGAACGGGCCTGTGACCTCCG

GCTCCCGCCAG - UNI11051 - - UNI22421 - - UNI22436 - - UNI29461 - - UNI29498 - - UNI29500 - GAGAATGGTG

CCAGCGTGATCCTCCGAGACATTGCAAGAGCCAGAGAGAACATCCAGAAATCCTTGGCTGGA - UNI22436 - - UNI24891 - - UNI29461 

- - UNI29498 - - UNI29500 - AGCTCAGGCCCTGGAGCCTCCAGTGGACCTGGTGGAGACCACAGTGAGCTCATTGTGAGGATTACCAGTCTG

GAAGTGGAGAACCAGAACCTTCGAGGCG - UNI24891 - TGGTGCAAGATTTGCAGCAGGCCATTTCCAAGTTGGAGGCCCGGCTGAGCTCTCTAGA

GAAGAGTTCACCTACTCCCCGAGCCACGGCCCCACAGACCCAA CATGTCTCTCCTATGCGTCAAGTGGAGCCCCCAACCAAGAAAGGAGCCACACCAGC

AGAGGACGATGAGGACAAGGACATTGACCTGTTCGGCAGTGACGAGGAGGAAGAAGATAAGGAGGCTGCCCGACTACGGGAGGAGAGGCTACGCCAGTAC

GCAGAGAAGAAGGCCAAGAAGCCCACACTGGTGGCCAAATCCTCCATCCTTTTGGATGTTAAACCT - UNI4804 - TGGGATGATGAGACTGACATG

GCCCAGCTAGAGACTTGTGTGCGTTCCATCCAATTGGACGGGCTGGTTTGGGGGGCCTCCAAGCTTGTGCCTGTTGGCTATGGCATCCGGAAGCTGCAGA

TCCAGTGTGTGGTGGAGGATGACAAAGTGGGCACCGACTTGCTCGAGGAGGAGATCACCAAATTTGAGGAGCAT - UNI4804 - GTGCAGAGTGTCG

ACATCGCAGCTTTCAACAAGATCTGAATGTCCGAGAGAGTGTGGTTTCATGTGTGTGAGGACCTGCTGAGATTAAAGACTGAGACTCTG
Translation
 - UNI7339 - - UNI29484 -  - UNI29484 - MRSGKASCALETVWEDRHKYEGAERRFHEQEATQVVAAAATAAATASASVQQLLDEVPAV

NGPSQEDTEDTEEAEAPNTSSRSDPGKSHECKKPIQKKRKRSPKSWLGQADLALVGLSADHVWLDKPLFDQAESSYRQRLADVAAQAAQPPALAPRGPCT

HGSHVACHHVTWGIWVNKSCFDQAERAFVEWSQSLLLAAEGSHRQGTPDTGQQAVTPDLALACQPCPPANGQPPLGSLQALVREVWLEKPRYDAAERGFY

EALFDGHPPGKVRLQERASQAEGTRRGRRDHRSCNNVGNKRAGSKRANGEAPPAFPYWYFLHKDAEAPWLSKPTYDSAECRHHAVEALRIAWRLEAASLA

HRPTPRSGPSMSSLRPN - UNI11051 - - UNI22421 - NRKMATNFLAHEKIWFDKFKYDDAERRFYEQMNGPVTSGSRQ - UNI11051 - 

- UNI22421 - - UNI22436 - - UNI29461 - - UNI29498 - - UNI29500 - ENGASVILRDIARARENIQKSLAG - UNI22436

 - - UNI24891 - - UNI29461 - - UNI29498 - - UNI29500 - SSGPGASSGPGGDHSELIVRITSLEVENQNLRGV - UNI24891

 - VVQDLQQAISKLEARLSSLEKSSPTPRATAPQTQ HVSPMRQVEPPTKKGATPAEDDEDKDIDLFGSDEEEEDKEAARLREERLRQYAEKKAKKPTL

VAKSSILLDVKP - UNI4804 - WDDETDMAQLETCVRSIQLDGLVWGASKLVPVGYGIRKLQIQCVVEDDKVGTDLLEEEITKFEEH - UNI4804

 - VQSVDIAAFNKI
Transcript ENSMUST00000109976
Sequence
CTCTCCTTTGCAGTCCTGAGCTCGCAGTTCCAGGTTTTGGTTGCTGCGTCCTTGGCTGGCGT - UNI7339 - - UNI11051 - - UNI22421 -

 - UNI29484 - CAGAAAAATGGCTACAAACTTTCTAGCGCATGAGAAGATCTGGTTTGACAAGTTTAAATATGATGATGCAGAAAGGAGATTCTATG

AGCAGATGAACGGGCCTGTGACCTCCGGCTCCCGCCAG - UNI11051 - - UNI22421 - - UNI22436 - - UNI29461 - - UNI2949

8 - - UNI29500 - CTCAAGGTGATGCTGCCCAACTCCCCTGAGGCCCTGGGCCAGGCCACCCCTGGGACT - UNI24891 - - UNI29498 -

 AGCTCAGGCCCTGGAGCCTCCAGTGGACCTGGTGGAGACCACAGTGAGCTCATTGTGAGGATTACCAGTCTGGAAGTGGAGAACCAGAACCTTCGAGGC

G - UNI24891 - TGGTGCAAGATTTGCAGCAGGCCATTTCCAAGTTGGAGGCCCGGCTGAGCTCTCTAGAGAAGAGTTCACCTACTCCCCGAGCCAC

GGCCCCACAGACCCAA CATGTCTCTCCTATGCGTCAAGTGGAGCCCCCAACCAAGAAAGGAGCCACACCAGCAGAGGACGATGAGGACAAGGACATTGA

CCTGTTCGGCAGTGACGAGGAGGAAGAAGATAAGGAGGCTGCCCGACTACGGGAGGAGAGGCTACGCCAGTACGCAGAGAAGAAGGCCAAGAAGCCCACA

CTGGTGGCCAAATCCTCCATCCTTTTGGATGTTAAACCT - UNI4804 - TGGGATGATGAGACTGACATGGCCCAGCTAGAGACTTGTGTGCGTTCC

ATCCAATTGGACGGGCTGGTTTGGGGGGCCTCCAAGCTTGTGCCTGTTGGCTATGGCATCCGGAAGCTGCAGATCCAGTGTGTGGTGGAGGATGACAAAG

TGGGCACCGACTTGCTCGAGGAGGAGATCACCAAATTTGAGGAGCAT - UNI4804 - GTGCAGAGTGTCGACATCGCAGCTTTCAACAAGATCTGAA

TGTCCGAGAGAGTGTGGTTTCATGTGTGTGAGGACCTGCTGAGATTAAAGACTGAGACTC
Translation
 - UNI7339 - - UNI11051 - - UNI22421 - - UNI29484 - MATNFLAHEKIWFDKFKYDDAERRFYEQMNGPVTSGSRQ - UNI110

51 - - UNI22421 - - UNI22436 - - UNI29461 - - UNI29498 - - UNI29500 - LKVMLPNSPEALGQATPGT - UNI24891

 - - UNI29498 - SSGPGASSGPGGDHSELIVRITSLEVENQNLRGV - UNI24891 - VVQDLQQAISKLEARLSSLEKSSPTPRATAPQTQ H

VSPMRQVEPPTKKGATPAEDDEDKDIDLFGSDEEEEDKEAARLREERLRQYAEKKAKKPTLVAKSSILLDVKP - UNI4804 - WDDETDMAQLETCV

RSIQLDGLVWGASKLVPVGYGIRKLQIQCVVEDDKVGTDLLEEEITKFEEH - UNI4804 - VQSVDIAAFNKI
Transcript ENSMUST00000023235
Sequence
CTCTCCTTTGCAGTCCTGAGCTCGCAGTTCCAGGTTTTGGTTGCTGCGTCCTTGGCTGGCGT - UNI7339 - - UNI11051 - - UNI22421 -

 - UNI29484 - CAGAAAAATGGCTACAAACTTTCTAGCGCATGAGAAGATCTGGTTTGACAAGTTTAAATATGATGATGCAGAAAGGAGATTCTATG

AGCAGATGAACGGGCCTGTGACCTCCGGCTCCCGCCAG - UNI11051 - - UNI22421 - - UNI22436 - - UNI29461 - - UNI2949

8 - - UNI29500 - GAGAATGGTGCCAGCGTGATCCTCCGAGACATTGCAAGAGCCAGAGAGAACATCCAGAAATCCTTGGCTGGA - UNI22436

 - - UNI24891 - - UNI29461 - - UNI29498 - - UNI29500 - AGCTCAGGCCCTGGAGCCTCCAGTGGACCTGGTGGAGACCACAGT

GAGCTCATTGTGAGGATTACCAGTCTGGAAGTGGAGAACCAGAACCTTCGAGGCG - UNI24891 - TGGTGCAAGATTTGCAGCAGGCCATTTCCAA

GTTGGAGGCCCGGCTGAGCTCTCTAGAGAAGAGTTCACCTACTCCCCGAGCCACGGCCCCACAGACCCAA CATGTCTCTCCTATGCGTCAAGTGGAGCC

CCCAACCAAGAAAGGAGCCACACCAGCAGAGGACGATGAGGACAAGGACATTGACCTGTTCGGCAGTGACGAGGAGGAAGAAGATAAGGAGGCTGCCCGA

CTACGGGAGGAGAGGCTACGCCAGTACGCAGAGAAGAAGGCCAAGAAGCCCACACTGGTGGCCAAATCCTCCATCCTTTTGGATGTTAAACCT - UNI4

804 - TGGGATGATGAGACTGACATGGCCCAGCTAGAGACTTGTGTGCGTTCCATCCAATTGGACGGGCTGGTTTGGGGGGCCTCCAAGCTTGTGCCTG

TTGGCTATGGCATCCGGAAGCTGCAGATCCAGTGTGTGGTGGAGGATGACAAAGTGGGCACCGACTTGCTCGAGGAGGAGATCACCAAATTTGAGGAGCA

T - UNI4804 - GTGCAGAGTGTCGACATCGCAGCTTTCAACAAGATCTGAATGTCCGAGAGAGTGTGGTTTCATGTGTGTGAGGACCTGCTGAGATT

AAAGACTGAGACTC
Translation
 - UNI7339 - - UNI11051 - - UNI22421 - - UNI29484 - MATNFLAHEKIWFDKFKYDDAERRFYEQMNGPVTSGSRQ - UNI110

51 - - UNI22421 - - UNI22436 - - UNI29461 - - UNI29498 - - UNI29500 - ENGASVILRDIARARENIQKSLAG - UNI

22436 - - UNI24891 - - UNI29461 - - UNI29498 - - UNI29500 - SSGPGASSGPGGDHSELIVRITSLEVENQNLRGV - UNI

24891 - VVQDLQQAISKLEARLSSLEKSSPTPRATAPQTQ HVSPMRQVEPPTKKGATPAEDDEDKDIDLFGSDEEEEDKEAARLREERLRQYAEKKA

KKPTLVAKSSILLDVKP - UNI4804 - WDDETDMAQLETCVRSIQLDGLVWGASKLVPVGYGIRKLQIQCVVEDDKVGTDLLEEEITKFEEH - UN

I4804 - VQSVDIAAFNKI
Transcript ENSMUST00000109975
Sequence
ATGAGGAGTGGGAAGGCCTCTTGTGCACTGGAGACCGTCTGGGAGGACAGGCACAAGTATGAGGGAGCCGAGCGGCGCTTCCACGAGCAGGAGGCCACAC

AAGTCGTCGCCGCCGCCGCCACTGCCGCCGCCACTGCCTCCGCCTCTGTCCAGCAGCTCCTGGACGAAGTGCCAGCTGTGAACGGGCCCAGCCAGGAGGA

CACAGAGGACACTGAGGAGGCAGAGGCCCCAAACACCAGCAGCAGGAGTGATCCCGGGAAGAGCCACGAGTGCAAGAAGCCGATACAGAAAAAGAGGAAG

CGCTCCCCGAAAAGTTGGCTGGGCCAGGCAGACCTGGCCCTTGTGGGCCTCTCGGCTGACCACGTATGGTTAGACAAGCCACTCTTCGACCAGGCAGAAA

GCTCCTACCGTCAGAGGCTGGCAGATGTAGCTGCCCAGGCAGCCCAGCCGCCTGCTCTGGCCCCTCGGGGGCCCTGTACACATGGAAGCCATGTGGCATG

CCACCATGTAACCTGGGGGATCTGGGTCAACAAGTCTTGCTTTGATCAAGCCGAGCGGGCTTTTGTGGAGTGGTCTCAGTCCTTGCTGCTGGCTGCAGAG

GGGAGCCATAGGCAGGGGACTCCTGACACAGGCCAGCAGGCTGTCACTCCTGACCTGGCCTTGGCCTGCCAGCCTTGCCCACCAGCCAATGGCCAGCCTC

CTCTGGGCAGCCTGCAGGCACTGGTGCGGGAGGTATGGCTGGAGAAGCCCCGGTACGATGCCGCTGAGAGGGGCTTCTATGAGGCCCTGTTTGATGGTCA

TCCCCCAGGGAAAGTGCGCCTGCAGGAGCGAGCCAGTCAGGCAGAGGGTACCCGGAGGGGCCGCAGAGACCATCGGAGCTGCAATAACGTAGGAAACAAG

AGAGCTGGGTCAAAACGGGCCAACGGGGAGGCTCCTCCTGCTTTTCCCTACTGGTACTTCCTACACAAGGACGCAGAGGCCCCCTGGCTCAGCAAGCCTA

CCTACGACAGCGCTGAGTGCCGCCACCATGCCGTTGAGGCCCTGCGCATAGCCTGGCGCCTAGAAGCTGCCTCCCTGGCTCACCGACCCACACCCCGTTC

TGGCCCATCCATGTCCAGCCTGAGACCCAA - UNI11051 - - UNI22421 - CAGAAAAATGGCTACAAACTTTCTAGCGCATGAGAAGATCTGG

TTTGACAAGTTTAAATATGATGATGCAGAAAGGAGATTCTATGAGCAGATGAACGGGCCTGTGACCTCCGGCTCCCGCCAG - UNI11051 - - UNI

22421 - - UNI22436 - - UNI29461 - - UNI29498 - - UNI29500 - GAGAATGGTGCCAGCGTGATCCTCCGAGACATTGCAAGAG

CCAGAGAGAACATCCAGAAATCCTTGGCTGGA - UNI22436 - - UNI24891 - - UNI29461 - - UNI29498 - - UNI29500 - AG

CTCAGGCCCTGGAGCCTCCAGTGGACCTGGTGGAGACCACAGTGAGCTCATTGTGAGGATTACCAGTCTGGAAGTGGAGAACCAGAACCTTCGAGGCG -

 UNI24891 - TGGTGCAAGATTTGCAGCAGGCCATTTCCAAGTTGGAGGCCCGGCTGAGCTCTCTAGAGAAGAGTTCACCTACTCCCCGAGCCACGGC

CCCACAGACCCAA CATGTCTCTCCTATGCGTCAAGTGGAGCCCCCAACCAAGAAAGGAGCCACACCAGCAGAGGACGATGAGGACAAGGACATTGACCT

GTTCGGCAGTGACGAGGAGGAAGAAGATAAGGAGGCTGCCCGACTACGGGAGGAGAGGCTACGCCAGTACGCAGAGAAGAAGGCCAAGAAGCCCACACTG

GTGGCCAAATCCTCCATCCTTTTGGATGTTAAACCT - UNI4804 - TGGGATGATGAGACTGACATGGCCCAGCTAGAGACTTGTGTGCGTTCCATC

CAATTGGACGGGCTGGTTTGGGGGGCCTCCAAGCTTGTGCCTGTTGGCTATGGCATCCGGAAGCTGCAGATCCAGTGTGTGGTGGAGGATGACAAAGTGG

GCACCGACTTGCTCGAGGAGGAGATCACCAAATTTGAGGAGCAT - UNI4804 - GTGCAGAGTGTCGACATCGCAGCTTTCAACAAGATCTGAATGT

CCGAGAGAGTGTGGTTTCATGTGTGTGAGGACCTGCTGAGATTAAAGACTGAGACTC
Translation
MRSGKASCALETVWEDRHKYEGAERRFHEQEATQVVAAAATAAATASASVQQLLDEVPAVNGPSQEDTEDTEEAEAPNTSSRSDPGKSHECKKPIQKKRK

RSPKSWLGQADLALVGLSADHVWLDKPLFDQAESSYRQRLADVAAQAAQPPALAPRGPCTHGSHVACHHVTWGIWVNKSCFDQAERAFVEWSQSLLLAAE

GSHRQGTPDTGQQAVTPDLALACQPCPPANGQPPLGSLQALVREVWLEKPRYDAAERGFYEALFDGHPPGKVRLQERASQAEGTRRGRRDHRSCNNVGNK

RAGSKRANGEAPPAFPYWYFLHKDAEAPWLSKPTYDSAECRHHAVEALRIAWRLEAASLAHRPTPRSGPSMSSLRPN - UNI11051 - - UNI2242

1 - NRKMATNFLAHEKIWFDKFKYDDAERRFYEQMNGPVTSGSRQ - UNI11051 - - UNI22421 - - UNI22436 - - UNI29461 - -

 UNI29498 - - UNI29500 - ENGASVILRDIARARENIQKSLAG - UNI22436 - - UNI24891 - - UNI29461 - - UNI29498 

- - UNI29500 - SSGPGASSGPGGDHSELIVRITSLEVENQNLRGV - UNI24891 - VVQDLQQAISKLEARLSSLEKSSPTPRATAPQTQ HV

SPMRQVEPPTKKGATPAEDDEDKDIDLFGSDEEEEDKEAARLREERLRQYAEKKAKKPTLVAKSSILLDVKP - UNI4804 - WDDETDMAQLETCVR

SIQLDGLVWGASKLVPVGYGIRKLQIQCVVEDDKVGTDLLEEEITKFEEH - UNI4804 - VQSVDIAAFNKI

For any suggestions or comments, please send an email to unitrap@crg.es