Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000055809 (6030429G01Rik)
Chromosomal location
Chr 7: 4474576 - 4484044 (-)
Description
RIKEN cDNA 6030429G01 gene Gene [Source:MGI Symbol;Acc:MGI:3588207]
RefSeq_dna
NM_001033548 
RefSeq_peptide
NP_001028720.1 
UniGene
Mm.425359 
MGI
MGI:3588207 
Uniprot/SWISSPROT
Q3UYV8 
Uniprot/SPTREMBL
B2RX55 
Human Ortholog
ENSG00000167646 (C19orf51)
Omim not available
UniTrap UNI32022
Vector Insertion
Chr 7: 4475745 - 4478134
Public Clones IST14463E4 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 59% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000094897
Sequence
ACTGTTGTGGTGGCTTCCAGGAGCTCAGCACAGGACCCTACCTACGGATATTTTGAAGAATAAAG AGCGATGACCACGCCTGCGGGCTCGGGCACCGGT

TATGGTAGTGTGTCCTGGTGGGGTCTGTCCCCGGCGCTGGACCTACAGGCAGAAA GTCCTCCTGTAGACCCAGATTCACAGTCGAAAACAGAGCGCAAG

GTCCCAGAACTGGATGCCCTGCTGTTAGGTTCTGTGGATGGTAGACACATGCTGCGGACCCTGGCCAGGGCAGCGCTCTGGCCTCTCAGGAGCTTCAAT 

TTTTATGTGCTGGAGAATAATCTGGAAGCGGTAGCCCGACACATGCTGATCTTCAGTCTAGCCCTAGAGGAACCTGAGAAGATGGGGCTCCAAG AGCGG

AGTGAGACCTTCCTGGAGCTGTGGGGGAACGCGCTGCTGCGACCCTCGGTAGCTGCCTTCCTGCGCGCTCAGGCTAGCCACCTGGCTAATCTGGTCCTGG

AGCCTGATCGCCTGGAGGAGCAACTACCCTGGCTTAGTCTTCGGCTGCTCAAG TTCCGCGAGCGGGATGCCCTGGAGGCCGTGTTCCGTTTCTGGTCTG

GTGGGGAGAAGGGACCTGAAGTCTTTCCCATGAGTCGCCTTTGGGACTCGAGGTTGCGCCACTACCTGGGTTCCCGCTACGATGCCCGGCGTGGTGTTGC

CGACTGGGACCTACGCATGAAGCTGCATGATCGAGGG GCCCAAGTTATCCATATCCAGGAATTCCGACGCTGGCGGGATACAGGTGTTGCCTTTGAACT

CAGAGACTTGAGTGCTTACCATGTGCCCAACAGGACTCTGGCATCAGGTCGCCTCCTGAGCCAC CGTGGGGAACGCGTGGCTGCGCGCGGATACTGGGG

GGACATCGCCACGGGGCCCTTTATGGCTTTTGGCATCGAGGCGGACGACCAAAGCCTCTTACGGACGAGAAACGGACAACCAGTCAAG - UNI32022 

- ACTGCGAGCGAGATCACGCAGCACAACGTCACAGAGCTGTTCCGAGAAGTAGCCGCCTGGAGGGGCCCGAGAGCCATCCAGGGGAATGTGGAGGAGAC

AGAGTCGCCCGAGCCAGATG - UNI32022 - TGCCTGCTCAAGAACCCTTCACTATCCACTTTCTGCCTCTCGATTCTTCGCAGACTCTCCACCACA

AGACTTGCTACCAGGGCCGGTTCCAGCTCCTCTACGTGTCCTGTGG - UNI32022 - GATGGTCCATCTTCTCAGCCCTGAGCTCGGGGCTTGCGTG

GCCCCCGGAGGGAACCTGGTTGTGGAATTAGCTCG GTACTTGGTGGACCTGCGGCCCAAGGAGTTGAAGGCGTTCTCTGACCGCGTTGTAGAGATAGCG

CGGGTGGCTGGGTTCGCCCCTCACACTGCAACCAAACCCTCGGAGACTTTTGCGAGGTTCTACAAGTTAGGGGACTCCACTCCGGGTGGCGGAGACTCAG

CTGTGGAATCTGGACCCGCGCCCTCCAAAGTGGAATCTACCCGCGCCCCTCTCCCAGAATCGATAAGTCCGCCCCAGGCTAACCAGGCCCCCTCTCTAGA

GGCGATGAGCCCACCCCTGGCTGACCTGGCCCCACCTCTAGAGACAATGTGTCCACCCCAGGCCAACCAGGCCCCTCCTCTAGAAGCGTTGAGCCCATCC

AAAGCTGACCAGATCCCACCTCTAGAGGCGATGAGCCCACCCCAGGCTAAGCTAGTCCTGCCTGTAGAAGCAATCAGCCTTCCCCAAGCCGACCTGGCCT

CTCCTCCGGAAGTGATAAGCCCACTCCAGGAAGCTATGGCAACGTCCTGGGTGAATGCACCTCCAAAACATGTAACATGAACCCCAGGGACCACGTAGCC

CACCTTTAACTGCTGAAGCAGGCCCAGGGATTGACATCACCAGCTCAGCCCACCTGCATGCGGTTTTACTCTGCGTTCCTTCTCAACCCCAGGGATATGA

CTAGAACTTCAAATTCCTTTCCTGGAACTCTCGGTTGTACTATTTGGGGGGTAGGGGTGAGGGTGGGGGATGGGTCCTAGACTGTTATCTGAGACTTATC

CTGACAAGGATCGAAGGCTGAAGGGACAACCCTGGGCTCCAGATCCTCTCTTTTGTCTTGGGCCTTTCTTGACATGCTGCTTTTGGGAAGGACAAGGGCA

TAGCCTTCCTTGAATGTGATTC
Translation
 MTTPAGSGTGYGSVSWWGLSPALDLQAES SPPVDPDSQSKTERKVPELDALLLGSVDGRHMLRTLARAALWPLRSFN FYVLENNLEAVARHMLIFSL

ALEEPEKMGLQE ERSETFLELWGNALLRPSVAAFLRAQASHLANLVLEPDRLEEQLPWLSLRLLK FRERDALEAVFRFWSGGEKGPEVFPMSRLWDSR

LRHYLGSRYDARRGVADWDLRMKLHDRG AQVIHIQEFRRWRDTGVAFELRDLSAYHVPNRTLASGRLLSH RGERVAARGYWGDIATGPFMAFGIEADD

QSLLRTRNGQPVK - UNI32022 - TASEITQHNVTELFREVAAWRGPRAIQGNVEETESPEPDV - UNI32022 - VPAQEPFTIHFLPLDSSQT

LHHKTCYQGRFQLLYVSCG - UNI32022 - GMVHLLSPELGACVAPGGNLVVELAR RYLVDLRPKELKAFSDRVVEIARVAGFAPHTATKPSETFA

RFYKLGDSTPGGGDSAVESGPAPSKVESTRAPLPESISPPQANQAPSLEAMSPPLADLAPPLETMCPPQANQAPPLEALSPSKADQIPPLEAMSPPQAKL

VLPVEAISLPQADLASPPEVISPLQEAMATSWVNAPPKHVT

For any suggestions or comments, please send an email to unitrap@crg.es