Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000055923 (Aasdh)
Chromosomal location
Chr 5: 77304960 - 77334539 (-)
Description
aminoadipate-semialdehyde dehydrogenase Gene [Source:MGI Symbol;Acc:MGI:2442517]
RefSeq_dna
NM_173765 
RefSeq_peptide
NP_776126.1 
MGI
MGI:2442517 
Uniprot/SWISSPROT
Q80WC9 
Human Ortholog
ENSG00000157426 (AASDH)
Omim not available
UniTrap UNI14545
Vector Insertion
Chr 5: 77333233 - 77334540
Public Clones FHCRC-GT-S6-8F1 (fhcrc) IST12453D2 (tigm) IST14528H7 (tigm)
Private Clones OST448856 (lexicon) OST425861 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI23090
Vector Insertion
Chr 5: 77331213 - 77333233
Public Clones not available
Private Clones OST276817 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI18116
Vector Insertion
Chr 5: 77330307 - 77330942
Public Clones not available
Private Clones OST429863 (lexicon) OST345126 (lexicon)
Severity of mutation (?) Insertion after 7% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI26010
Vector Insertion
Chr 5: 77325716 - 77330185
Public Clones not available
Private Clones OST146512 (lexicon)
Severity of mutation (?) Insertion after 11% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000120963
Sequence
GGGCGCCCGAAGATGACGCAGAGGTCCGTTTTACGGCTGCTGAGCGTCTGCGGCTGGGCTAGGAAGTGCACGCCACGCGCTGTCGTGAGAAG - UNI14

545 - GTATAGCAGTGTTTTACCTGCATGTATGTAAGTGCACCATGTTCGTGCCTGGTGTCTTCAAAGGCTGTGGGATCAGCCAGAACTGGAACTATGG

ACTGTATTGAGCTCCCCAGTTGGGTGCTGGTATGGAATCTGTGTCTTCTGAAAGAACAAGGACGGTTTAACTCCTGAG - UNI14545 - - UNI230

90 - ATTTCTCAGCCACCAATGTTTAGACAAACCTCAATAAAATGACTCTTCAGGAGTTGGTGCTTCGGACTGCCTCTGTCTATATGGATAGAACAGCT

GTATGTTTTGACGAAGGCAATAACCAGCCTCCAGTGTGCTATTCCTACAAGGCTCTGTTGAGCGCGGCTTCAGAATTATCCCATTTTCTGATAGCACACT

GTGACTTTGGAGGAATTCGGGAAATTGGTCTCTATTGTCAACCTGGGATAAACTTACCCTCCTGGATTTTAGG - UNI18116 - GATTCTTCAGGTC

CCCGCAGCGTATGCGCCCATTGATCCAGACTCCCCACCGTCCTTATCAACTTACTTTATGAAAAAATGTGACCTAAAGTATGTTCTCGTTGAAAAACAGC

AGCTTAGT - UNI26010 - AAATTCAAATCTTCACATGAGACAGTTCTGAACTATGACACAGTTTCCGTGGAACACAAGGACCTGGCACTCTTCAGA

CTGCATTGGGAAGATGGTCGGGTGAGCACAGTGCTTGGTGACAGAGCAGATCAGCACAAGGTGACGGATAGAGAAGACAGAGTGAGTGCTGAGAGCAGGA

CCCCAGAGAAGGAGCACATGGACATGCGGCATGACGGTTGCTTGGCTTATGTCCTCCATACCTCAGGGACCACGGGGACACCGAAGATTGTCAGAGTGCC

CCATGCATGCATACTGCCTAATATCCAGCACTTCCG GTCACTTTTTGACATCACTCAAGAAGACATTTTGTTTCTGGCTTCTCCTCTGACCTTCGATCC

ATCTGTTGTGGAGATATTTGTTTCTCTGTCCAGTGGGGCCTGCCTGCTTATCGTGCCAACTTCTGTCAAAGTGCTACCATCAAAATTAGCTGACATTCTC

TTTTCCCGCCACAGAGTGACTGTTTTACAG GCAACGCCAACATTGCTGAGAAGATTTGGATCTGAGCTCATCAAGTCCACTGTCCTGTCAGCGCATACG

TCTCTGAGAGTCCTGGCCCTCGGTGGGGAAGCCTTCCCCTCGCTGACCATCCTCAAAAGCTGGCGAGGCAAAGGCAACAGAACCCAGATATTTAACATCT

ATGGTATCACAGAGGTATCCAGCTGGGCCACTTTTTACAGGATCCCAGAGGAGATTCTTAATTCTGCCGTGAA ACATGAATCCCCTGTGCAGCTGGGGT

CGCCACTACTTGGAACGGTGATTGAAGTCAGAGACCAAAATGGTTCTCCAGTTCTCGAAGGCACTGGCCAAGTATTTTTAG GTGGGAAGAACAGAGTGT

GTTTTCTTGATGATGAAATGACAGTGCCCCTTGGCACCATGAGAGCCACAGGAGACTTTGTGACTGTGAAAGATGGAGAGATATTTTTCTTGGGAAGAAA

GGACAGCCAGATCAAGCGCCATGGCAAACGTCTTAACATTGCACTTGTGCAACAG GTTGCTGAAGAACTTCGCCAGGTGGAGTCCTGCGCGGTCACTTG

GTATAATCAGGAAAGATTGATTCTCTTCATCGTATCCAAAGTTGACTTAGTAAAGGACTGCATCTTTAAAGAATTGCAGAAACACCTTCCAGCACACGCC

CTGCCTGATGACATGGTGCTGATCGATACCCTGCCATTTACATGCCATG GCAAAGTTGATGTTTCTGAGTTAAACAAGATATATTTAGACTACATAAGC

TCACAGCCTAGGAATGAACTCCATGGAAAAGAGGAACTTTGGGGAAAATTACAGTATTTATGGAAG TCTATTCTGTGTCTCCCTGAGGATCCAGAGGAT

ACTCTGAAGGTTCCCGCCAACTCCGTCTTTTTAGATAGTGGTGGGGATTCCCTCAAGTCCATGCGGCTCCTCAGTGAGATTGAGAGGCTCACCGGGACAG

CCATCCCTGGCCTTCTGGAAGTTATCCTCAGCAGTTCCCTCTTAGACGTTTACAACCACATCGTTCAAGCCGTGTTCACACCGGAGGACAGGAAAGCCAA

CAGGAGTTACACCACAAAAAGGAAATTCAGTGATGCTGATCCAGAGGAAGCCAGCGGGAAGCCTGCACGTCTGGAGTCTGCCTGGCCTTCGAACCATGCC

GGCGAGACCAACTCCGTGATCGCTCTGAGCAGAGGGAGTCAGGTTTTGTCTCTTGGCGCTGGGAGGCTTTTAACTCAGTTAGGACTCTGCCTGCCAGTCT

GTTCTCTGGATTTAATCCCACAGACTAACACTCAGATATTAAAAAGCCTAAGTCCTCCAGCTCCTGATGAAAACTTGGAAAAGCCCCCACTTTTTCAGCA

GGGGAGCCCCGTGGTTGGGGCTATGGCGATGGCATTGCGGGAGAGGTGGCGGTCAGACACAGGCAAATGCGTTGATGCCTCCCCTCTGCTGGTGAGAGCG

GCTGTACAGGATAAGCCCTCCACAACCGTGTATATTGGCTCGCACTCGCACACAGTGAAGGCTGTCGACCTGTCCTCTGGGGAGACGAGGTGGGAACAGC

TTCTGGGAGATCGAATTGAATCCTCAGCGTGTGTGTCTAAATGTGGAAACTTTATTGTAGTGG GCTGTTATAATGGATTAGTCTATGTCCTAAAAAGTA

ATAGTGGAGAAAAATATTGGACATTTACTACTGAAGATGCTGTCAAAAGCTCACCAGCCGTGGATCCAACCACAGGACTCATTTATGTCGGATCTCATGA

CCAGCACGCATATGCTTTAGACATTTAT GAAAAGAAATGTGTCTGGAAGCTAAACTGTGAAGGCGCTCTCTTTTCCTCTCCGTGTGTGAGCCTGAGTCC

ACACCATCTGTACTGTGCTACGCTAGGGGGACTCTTACTGGCCCTAAATCCT GCTTCTGGGAGCACGGTGTGGAAGCGCTCCTGTGGAAAGCCACTCTT

CTCTTCCCCACGGTGCTACCAGCAATACATCTGCATCGGCTGCGTGGACGGCAGTTTGCTCTGTTTCACACACTCAGGGGAGCAG GTCTGGCGCTTTGC

TGCTGGAGGGCCAATCTTCTCATCCCCATGCGTCTCGGCAGCAGAACAAGAAATATTTTTTGGTTCCCATGACTGCTTTATCTACTGCTGTAGCAAGGAA

GGTCACCTCCGGTGGAAATTTGAGACGACAGCCAGGGTGTATGCAACGCCCTTTGCTTTCAGTAACCACCCCCGTAGCGATGATGCACTGCTGGCAGCGG

CATCCACTGACGGGAAACTGTGGGTCCTCGAGTCTCGGAGCGGAGAGCTGCGAAGTGTGTATGAACTCCCCGGAGAAGTCTTCTCCTCTCCTGTGGTCTG

GGAATCAATGCTTGTTATTGGGTGCAGAAACAATTATATTTACTGTCTGGATTTATTGTGTGGTGATAAAAATAACCAGGTGTAGTCCTTGTAAGTATGT

CAGTGAGAGGGTTGGAAATGTCATTGTAAAGCCTATGGATGGGTTTATATTAAAGATTCTATTTTGGTTAGGAA
Translation
 - UNI14545 -  - UNI14545 - - UNI23090 - MTLQELVLRTASVYMDRTAVCFDEGNNQPPVCYSYKALLSAASELSHFLIAHCDFGGIR

EIGLYCQPGINLPSWILG - UNI18116 - GILQVPAAYAPIDPDSPPSLSTYFMKKCDLKYVLVEKQQLS - UNI26010 - KFKSSHETVLNYD

TVSVEHKDLALFRLHWEDGRVSTVLGDRADQHKVTDREDRVSAESRTPEKEHMDMRHDGCLAYVLHTSGTTGTPKIVRVPHACILPNIQHFR RSLFDIT

QEDILFLASPLTFDPSVVEIFVSLSSGACLLIVPTSVKVLPSKLADILFSRHRVTVLQ ATPTLLRRFGSELIKSTVLSAHTSLRVLALGGEAFPSLTIL

KSWRGKGNRTQIFNIYGITEVSSWATFYRIPEEILNSAVK KHESPVQLGSPLLGTVIEVRDQNGSPVLEGTGQVFLG GGKNRVCFLDDEMTVPLGTMR

ATGDFVTVKDGEIFFLGRKDSQIKRHGKRLNIALVQQ VAEELRQVESCAVTWYNQERLILFIVSKVDLVKDCIFKELQKHLPAHALPDDMVLIDTLPFT

CHG GKVDVSELNKIYLDYISSQPRNELHGKEELWGKLQYLWK SILCLPEDPEDTLKVPANSVFLDSGGDSLKSMRLLSEIERLTGTAIPGLLEVILSS

SLLDVYNHIVQAVFTPEDRKANRSYTTKRKFSDADPEEASGKPARLESAWPSNHAGETNSVIALSRGSQVLSLGAGRLLTQLGLCLPVCSLDLIPQTNTQ

ILKSLSPPAPDENLEKPPLFQQGSPVVGAMAMALRERWRSDTGKCVDASPLLVRAAVQDKPSTTVYIGSHSHTVKAVDLSSGETRWEQLLGDRIESSACV

SKCGNFIVVG GCYNGLVYVLKSNSGEKYWTFTTEDAVKSSPAVDPTTGLIYVGSHDQHAYALDIY EKKCVWKLNCEGALFSSPCVSLSPHHLYCATLG

GLLLALNP ASGSTVWKRSCGKPLFSSPRCYQQYICIGCVDGSLLCFTHSGEQ VWRFAAGGPIFSSPCVSAAEQEIFFGSHDCFIYCCSKEGHLRWKFE

TTARVYATPFAFSNHPRSDDALLAAASTDGKLWVLESRSGELRSVYELPGEVFSSPVVWESMLVIGCRNNYIYCLDLLCGDKNNQV
Transcript ENSMUST00000069709
Sequence
AGATTTCTCAGCCACCAATGTTTAGACAAACCTCAATAAAATGACTCTTCAGGAGTTGGTGCTTCGGACTGCCTCTGTCTATATGGATAGAACAGCTGTA

TGTTTTGACGAAGGCAATAACCAGCCTCCAGTGTGCTATTCCTACAAGGCTCTGTTGAGCGCGGCTTCAGAATTATCCCATTTTCTGATAGCACACTGTG

ACTTTGGAGGAATTCGGGAAATTGGTCTCTATTGTCAACCTGGGATAAACTTACCCTCCTGGATTTTAGG - UNI18116 - GATTCTTCAGGTCCCC

GCAGCGTATGCGCCCATTGATCCAGACTCCCCACCGTCCTTATCAACTTACTTTATGAAAAAATGTGACCTAAAGTATGTTCTCGTTGAAAAACAGCAGC

TTAGT - UNI26010 - AAATTCAAATCTTCACATGAGACAGTTCTGAACTATGACACAGTTTCCGTGGAACACAAGGACCTGGCACTCTTCAGACTG

CATTGGGAAGATGGTCGGGTGAGCACAGTGCTTGGTGACAGAGCAGATCAGCACAAGGTGACGGATAGAGAAGACAGAGTGAGTGCTGAGAGCAGGACCC

CAGAGAAGGAGCACATGGACATGCGGCATGACGGTTGCTTGGCTTATGTCCTCCATACCTCAGGGACCACGGGGACACCGAAGATTGTCAGAGTGCCCCA

TGCATGCATACTGCCTAATATCCAGCACTTCCG GTCACTTTTTGACATCACTCAAGAAGACATTTTGTTTCTGGCTTCTCCTCTGACCTTCGATCCATC

TGTTGTGGAGATATTTGTTTCTCTGTCCAGTGGGGCCTGCCTGCTTATCGTGCCAACTTCTGTCAAAGTGCTACCATCAAAATTAGCTGACATTCTCTTT

TCCCGCCACAGAGTGACTGTTTTACAG GCAACGCCAACATTGCTGAGAAGATTTGGATCTGAGCTCATCAAGTCCACTGTCCTGTCAGCGCATACGTCT

CTGAGAGTCCTGGCCCTCGGTGGGGAAGCCTTCCCCTCGCTGACCATCCTCAAAAGCTGGCGAGGCAAAGGCAACAGAACCCAGATATTTAACATCTATG

GTATCACAGAGGTATCCAGCTGGGCCACTTTTTACAGGATCCCAGAGGAGATTCTTAATTCTGCCGTGAA ACATGAATCCCCTGTGCAGCTGGGGTCGC

CACTACTTGGAACGGTGATTGAAGTCAGAGACCAAAATGGTTCTCCAGTTCTCGAAGGCACTGGCCAAGTATTTTTAG GTGGGAAGAACAGAGTGTGTT

TTCTTGATGATGAAATGACAGTGCCCCTTGGCACCATGAGAGCCACAGGAGACTTTGTGACTGTGAAAGATGGAGAGATATTTTTCTTGGGAAGAAAGGA

CAGCCAGATCAAGCGCCATGGCAAACGTCTTAACATTGCACTTGTGCAACAG GTTGCTGAAGAACTTCGCCAGGTGGAGTCCTGCGCGGTCACTTGGTA

TAATCAGGAAAGATTGATTCTCTTCATCGTATCCAAAGTTGACTTAGTAAAGGACTGCATCTTTAAAGAATTGCAGAAACACCTTCCAGCACACGCCCTG

CCTGATGACATGGTGCTGATCGATACCCTGCCATTTACATGCCATG GCAAAGTTGATGTTTCTGAGTTAAACAAGATATATTTAGACTACATAAGCTCA

CAGCCTAGGAATGAACTCCATGGAAAAGAGGAACTTTGGGGAAAATTACAGTATTTATGGAAG TCTATTCTGTGTCTCCCTGAGGATCCAGAGGATACT

CTGAAGGTTCCCGCCAACTCCGTCTTTTTAGATAGTGGTGGGGATTCCCTCAAGTCCATGCGGCTCCTCAGTGAGATTGAGAGGCTCACCGGGACAGCCA

TCCCTGGCCTTCTGGAAGTTATCCTCAGCAGTTCCCTCTTAGACGTTTACAACCACATCGTTCAAGCCGTGTTCACACCGGAGGACAGGAAAGCCAACAG

GAGTTACACCACAAAAAGGAAATTCAGTGATGCTGATCCAGAGGAAGCCAGCGGGAAGCCTGCACGTCTGGAGTCTGCCTGGCCTTCGAACCATGCCGGC

GAGACCAACTCCGTGATCGCTCTGAGCAGAGGGAGTCAGGTTTTGTCTCTTGGCGCTGGGAGGCTTTTAACTCAGTTAGGACTCTGCCTGCCAGTCTGTT

CTCTGGATTTAATCCCACAGACTAACACTCAGATATTAAAAAGCCTAAGTCCTCCAGCTCCTGATGAAAACTTGGAAAAGCCCCCACTTTTTCAGCAGGG

GAGCCCCGTGGTTGGGGCTATGGCGATGGCATTGCGGGAGAGGTGGCGGTCAGACACAGGCAAATGCGTTGATGCCTCCCCTCTGCTGGTGAGAGCGGCT

GTACAGGATAAGCCCTCCACAACCGTGTATATTGGCTCGCACTCGCACACAGTGAAGGCTGTCGACCTGTCCTCTGGGGAGACGAGGTGGGAACAGCTTC

TGGGAGATCGAATTGAATCCTCAGCGTGTGTGTCTAAATGTGGAAACTTTATTGTAGTGG GCTGTTATAATGGATTAGTCTATGTCCTAAAAAGTAATA

GTGGAGAAAAATATTGGACATTTACTACTGAAGATGCTGTCAAAAGCTCACCAGCCGTGGATCCAACCACAGGACTCATTTATGTCGGATCTCATGACCA

GCACGCATATGCTTTAGACATTTAT GAAAAGAAATGTGTCTGGAAGCTAAACTGTGAAGGCGCTCTCTTTTCCTCTCCGTGTGTGAGCCTGAGTCCACA

CCATCTGTACTGTGCTACGCTAGGGGGACTCTTACTGGCCCTAAATCCT GCTTCTGGGAGCACGGTGTGGAAGCGCTCCTGTGGAAAGCCACTCTTCTC

TTCCCCACGGTGCTACCAGCAATACATCTGCATCGGCTGCGTGGACGGCAGTTTGCTCTGTTTCACACACTCAGGGGAGCAG GTCTGGCGCTTTGCTGC

TGGAGGGCCAATCTTCTCATCCCCATGCGTCTCGGCAGCAGAACAAGAAATATTTTTTGGTTCCCATGACTGCTTTATCTACTGCTGTAGCAAGGAAGGT

CACCTCCGGTGGAAATTTGAGACGACAGCCAGGGTGTATGCAACGCCCTTTGCTTTCAGTAACCACCCCCGTAGCGATGATGCACTGCTGGCAGCGGCAT

CCACTGACGGGAAACTGTGGGTCCTCGAGTCTCGGAGCGGAGAGCTGCGAAGTGTGTATGAACTCCCCGGAGAAGTCTTCTCCTCTCCTGTGGTCTGGGA

ATCAATGCTTGTTATTGGGTGCAGAAACAATTATATTTACTGTCTGGATTTATTGTGTGGTGATAAAAATAACCAGGTGTAGTCCTTGTAAGTATGTCAG

TGAGAGGGTTGGAAATGTCATTGTAAAGCCTATGGATGGGTTTATATTAAAGATTCTATTTTGGTTAGG
Translation
MTLQELVLRTASVYMDRTAVCFDEGNNQPPVCYSYKALLSAASELSHFLIAHCDFGGIREIGLYCQPGINLPSWILG - UNI18116 - GILQVPAAY

APIDPDSPPSLSTYFMKKCDLKYVLVEKQQLS - UNI26010 - KFKSSHETVLNYDTVSVEHKDLALFRLHWEDGRVSTVLGDRADQHKVTDREDRV

SAESRTPEKEHMDMRHDGCLAYVLHTSGTTGTPKIVRVPHACILPNIQHFR RSLFDITQEDILFLASPLTFDPSVVEIFVSLSSGACLLIVPTSVKVLP

SKLADILFSRHRVTVLQ ATPTLLRRFGSELIKSTVLSAHTSLRVLALGGEAFPSLTILKSWRGKGNRTQIFNIYGITEVSSWATFYRIPEEILNSAVK 

KHESPVQLGSPLLGTVIEVRDQNGSPVLEGTGQVFLG GGKNRVCFLDDEMTVPLGTMRATGDFVTVKDGEIFFLGRKDSQIKRHGKRLNIALVQQ VAE

ELRQVESCAVTWYNQERLILFIVSKVDLVKDCIFKELQKHLPAHALPDDMVLIDTLPFTCHG GKVDVSELNKIYLDYISSQPRNELHGKEELWGKLQYL

WK SILCLPEDPEDTLKVPANSVFLDSGGDSLKSMRLLSEIERLTGTAIPGLLEVILSSSLLDVYNHIVQAVFTPEDRKANRSYTTKRKFSDADPEEASG

KPARLESAWPSNHAGETNSVIALSRGSQVLSLGAGRLLTQLGLCLPVCSLDLIPQTNTQILKSLSPPAPDENLEKPPLFQQGSPVVGAMAMALRERWRSD

TGKCVDASPLLVRAAVQDKPSTTVYIGSHSHTVKAVDLSSGETRWEQLLGDRIESSACVSKCGNFIVVG GCYNGLVYVLKSNSGEKYWTFTTEDAVKSS

PAVDPTTGLIYVGSHDQHAYALDIY EKKCVWKLNCEGALFSSPCVSLSPHHLYCATLGGLLLALNP ASGSTVWKRSCGKPLFSSPRCYQQYICIGCVD

GSLLCFTHSGEQ VWRFAAGGPIFSSPCVSAAEQEIFFGSHDCFIYCCSKEGHLRWKFETTARVYATPFAFSNHPRSDDALLAAASTDGKLWVLESRSGE

LRSVYELPGEVFSSPVVWESMLVIGCRNNYIYCLDLLCGDKNNQV

For any suggestions or comments, please send an email to unitrap@crg.es