Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000055978 (Fut2)
Chromosomal location
Chr 7: 52903965 - 52921764 (-)
Description
fucosyltransferase 2 Gene [Source:MGI Symbol;Acc:MGI:109374]
RefSeq_dna
NM_018876 
RefSeq_peptide
NP_061364.2 
UniGene
Mm.290046 
MGI
MGI:109374 
Uniprot/SWISSPROT
Q9JL27 
Uniprot/SPTREMBL
A6H6C9 O70504 Q91VF0 Q920W3 
Human Ortholog
ENSG00000176920 (FUT2)
Omim 182100 - FUCOSYLTRANSFERASE 2  
UniTrap UNI33348
Vector Insertion
Chr 7: 52903964 - 52921765
Public Clones IST14751D6 (tigm) IST10019D4 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000069800
Sequence
CAGCCTCTCTGGTTCTAGGATGTCAGCAGGTACACCCTGGGTGGAGTTTCTATCCAGGGCTGTGGTTAAACTCAGGAAGTTTCCTTGGTCCTGAACGAAG

AGCCAAGCTGGAAGATACACACTGCCGTCCAGTCCGCAGAGCCACGCTGCGGTTCGTCCATTCCTAGGTCATTTCCCTGTTACCACAGCCAGAAGAG - 

UNI33348 - CCATGGCGAGTGCCCAGGTACCTTTCTCCTTTCCTCTGGCCCACTTCCTCATCTTTGTCTTTGTGACTTCCACCATCATCCACCTCCAG

CAACGAATAGTGAAGCTCCAAACCCTGTCAGAGAAGGAATTACAGGCGGTTCAAATGTCCTCACCAAACGCGGCAAGAACAGACATGCAGCAGAGTGCCA

AGCTGCAGGGCATATTCACGATCAATTCCATCGGCCGCCTGGGGAACCAGATGGGCGAATATGCTACATTGTTTGCACTGGCCAGGATGAACGGTCGGCT

TGCCTTCATCCCTGAATCCATGCACAACGCTCTAGCGCCCATCTTCAGGATCAGTCTCCCGGTGTTACACAGCGACACAGCCAGAAGGATCCCGTGGCAG

AATTACCACCTCAACGACTGGATGGAGGAGCGTTACCGCCACATCCCGGGGCAGTATGTGCGTTTCACGGGATACCCGTGCTCCTGGACCTTCTACCACC

ACCTGCGCCCAGAGATCCTGAAGGAGTTCACCCTGCACGACCATGTGCGTGAGGAGGCCCAGGCTTTCCTGCGTGGCCTGCGGGTGAATGGGAGCCAGCC

GAGTACCTTTGTGGGTGTCCATGTGCGCCGAGGGGACTATGTGCATGTCATGCCCAAGGTGTGGAAGGGCGTGGTGGCTGACCGGGGTTACCTAGAAAAG

GCCCTGGACAGGTTCCGGGCACGCTATTCATCTCCAGTCTTCGTGGTTACAAGCAACGGTATGGCCTGGTGCCGGGAGAACATCAACACCTCCCTAGGAG

ACGTGGTGTTTGCGGGCAATGGTATTGAGGGCTCACCAGCCAAGGACTTCGCGCTCCTCACCCAGTGCAACCACACCATCATGACCATTGGAACCTTTGG

GATTTGGGCTGCCTACCTGGCAGGTGGTGATACCATCTACCTAGCCAACTACACCCTTCCGGATTCTCCGTTCCTCAAAATCTTTAAGCCAGCAGCAGCC

TTCCTCCCCGAGTGGATGGGCATCCCCGCAGACCTGTCCCCACTCCTTAAGCACTAACAACCAGCCTGTCCTTGGTCCCATTTCCATCTCAAGGCAGAAG

GAGTCACTTGGTACATCCCAGGAAGGGCCTTCTACTGGGAAGATGTGTGCCTTGGACTGCCAACGAGAACTAATATGTGCAGAAAACGTATTACATGTTA

GATACAAGTTCCAACATTCATTAACAGCTCAGACATTATCAATGGCTCCTGTTCCTGAAAACTAACAGGCCTTCACCTTTTTTCAGCACAGCTGTCTCAT

GGTGCCAGCCGGGCTGCCACCCACAGACAGTCTCTTCCAGAGGCAGCAAGAAAAGGTGTGTTATCGATTTTACTTTAGGTTCCTTTTGAAGGGTAAGGCA

AACTCTTGTTTATACACTTTTTGTCATTAGCATTTCCATGGCGGGGCAGCATGCGACAGGCAATAACCATGTAAGGAAGCCTGAGAAAGGAGAGGAGGCT

GGCTTGCTCTTTTTATAGCAACTGCTTTTCACCAACTGACAGGAGTCTGCTGAGAACTGCTAACCCCTTTGAAAGTGGTGCCTTCAGTGACCTCAGAACG

TCTTATCATCTGTTAAGATTCTTTTTTTTTTTTAATTATGGATATATATGTGGGTGTGTGCAGTACCTTCAGAGGCCAGACCTGGGCGTTGGGTTCCTGG

GAACTGGAATCATAAGCAGCTGGCTCTGCCTCCCGAAGGTCTCACCGACAGTGGACCAAAGGCCAGGCCAGTGAAAGCCACACCTCTCCAAGCATCCAGC

CAGCTCTTCTGTCCCCTTGACAAGAGTTGTGTCACCGTGAGCTCACGTGGCTCATTATGAGTCAAGGGGAGGGAGAACGCTGGGATTGGTTTAGCCTAGG

ATCCAAAATAGGAGTTCTTCACTGCACAGATCAAAAGGGATGCGGGAGCTACCGTGGACCCACAGTCCCCTCACCAAGTTGCTTGTCCTTGGGACTTTGC

CTACTCTGTCCATCTGAGAAGAACTGAGTGAGTAGAATTCAGATGCATGTCCACTTCTGTAGCCCTGGCCGGACACCCCAGGCCTAGGGAACTCCTCCAG

ATGTTTCAGAGTGTCTTACCATCTTGTTAAACTTCACGTGTGAACACACATCATGCTATCTCTCACACAATTAAAGAATACAACCTATGTAGCCACCATT

ATGAAAACAGCCAGGGTGATGCAGGGGGCGGGGGCGGGCGGGGGAAGAAGCCTTGCAAAGGTGTTAGCTCAGGACAGCAGAATCCCAAGGTGTCTCTCCA

GACCCCCTGCTAAATTGGAAGTGCTGATCCTGTGCATGAGAAGTAGCCTGGAGTGGCCACGGTGGCACCTGCCTTTCATCCTTGCACTGTGAAGGCTAAG

GCAGGAGGCCAGCCTGGTCTATATCCTAAAACCCTGTCTCAAAAGATAAAATTCTCAAACTGGGTATAGTGGTGCACAGCGGTGGTCCCAGCATTAGGTA

AGTGCAGAAAGATCAAGAGTTGGAAGTCATCCACAGCTACACGGAATGGCAGACCAGTCTGAGCTGCATGAGAAGCCCCTTACCCCATCTCAGAAACAGA

AAGAAAATTACAGAAATCTAAGCTCCGCAGTGGCAGTATACACTCAGGAGGCAGCGGCCAGTAGATCTTTGGGTTTGAGGATAGCCTGGGCTACACAGAA

GTCCTATGTCACGAATTTTTTTTTTTTTTCAAAATCCAAAACAAATAAAAATGTGCCTCTCCATC
Translation
 - UNI33348 - MASAQVPFSFPLAHFLIFVFVTSTIIHLQQRIVKLQTLSEKELQAVQMSSPNAARTDMQQSAKLQGIFTINSIGRLGNQMGEYATL

FALARMNGRLAFIPESMHNALAPIFRISLPVLHSDTARRIPWQNYHLNDWMEERYRHIPGQYVRFTGYPCSWTFYHHLRPEILKEFTLHDHVREEAQAFL

RGLRVNGSQPSTFVGVHVRRGDYVHVMPKVWKGVVADRGYLEKALDRFRARYSSPVFVVTSNGMAWCRENINTSLGDVVFAGNGIEGSPAKDFALLTQCN

HTIMTIGTFGIWAAYLAGGDTIYLANYTLPDSPFLKIFKPAAAFLPEWMGIPADLSPLLKH

For any suggestions or comments, please send an email to unitrap@crg.es