Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000056076 (Eif3b)
Chromosomal location
Chr 5: 140895259 - 140919314 (+)
Description
eukaryotic translation initiation factor 3, subunit B Gene [Source:MGI Symbol;Acc:MGI:106478]
RefSeq_dna
NM_133916 
RefSeq_peptide
NP_598677.1 
UniGene
Mm.21671 
MGI
MGI:106478 
Uniprot/SWISSPROT
Q8JZQ9 
Uniprot/SPTREMBL
Q8CIJ3 
Human Ortholog
ENSG00000106263 (EIF3S9)
Omim not available
UniTrap UNI5600
Vector Insertion
Chr 5: 140895314 - 140895781
Public Clones YTA345 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI6842
Vector Insertion
Chr 5: 140895781 - 140901215
Public Clones YHA153 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 16% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI7911
Vector Insertion
Chr 5: 140903100 - 140903363
Public Clones RRM103 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 33% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI10968
Vector Insertion
Chr 5: 140906283 - 140906924
Public Clones P136D12 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 46% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI11533
Vector Insertion
Chr 5: 140906972 - 140908877
Public Clones P026E01 (ggtc) P023G08 (ggtc) IST13071A10 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 47% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI8893
Vector Insertion
Chr 5: 140916006 - 140916939
Public Clones XL017 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 69% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI3810
Vector Insertion
Chr 5: 140917066 - 140917690
Public Clones CD0145 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 73% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI37514
Vector Insertion
Chr 5: 140917769 - 140918077
Public Clones PST17523-NR (escells)
Private Clones not available
Severity of mutation (?) Insertion after 76% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI27668
Vector Insertion
Chr 5: 140918273 - 140918336
Public Clones not available
Private Clones OST54020 (lexicon)
Severity of mutation (?) Insertion after 79% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI16491
Vector Insertion
Chr 5: 140918827 - 140919313
Public Clones not available
Private Clones OST459829 (lexicon)
Severity of mutation (?) Insertion after 83% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000075771
Sequence
ATGCAGGACGCTGAGAACGTGGCGGTGCCCGAGGCGGCCGAGGAGCGGGCTGAGCCCGCGAGGCAGCAGCCGGCCTCCGAGTCGCCGCCGACGGACGAGG

CGGCAGGGTCTGGGGGGTCCGAAGTGGGGCAGACGGAAGACGCCGAAGAAGACGCCGAGGCCGGACCGGAGCCCGAAGTGAGGGCCAAGCCGGCGGCCCA

ATCCGAAGAGGAAACGGCGACGAGTCCGGCCGCCTCGCCCACGCCGCAGTCGGCGGAGCGGTCCCCGTCGCAGGAGCCCTCTGCTCCCGGGAAGGCAGAG

GCCGTTGGCGAGCAGGCCCGGGGGCACCCCTCGGCTGGAGCGGAGGAGGAGGGCGGGTCTGATGGGAGCGCGGCTGAGGCGGAGCCGCGGGCTCTGGAGA

ACGGAGAGGCAGATGAGCCCTCCTTCAGCGACCCCGAGGATTTCGTAGACGACGTGAGCGAGGAAG - UNI5600 - - UNI6842 - AACTACTTG

GTGATGTACTCAAAGATCGGCCTCAGGAAGCGGACGGGATTGACTCGGTGATTGTTGTAGACAACGTCCCTCAGGTGGGGCCAGACCGACTTGAGAAACT

CAAAAATGTCATCCACAAGATCTTCTCCAAGTTTGGGAAAATCATAAATGACTATTACCCTGAGGAGGACGGAAAGACGAAAGG GTACATCTTTCTGGA

GTACGCTTCTCCCGCCCATGCTGTGGATGCTGTGAAAAACGCCGATGGCTACAAGCTGGACAAGCAGCACACGTTCCGGGTCAACCTCTTCACCGACTTT

GACAA GTACATGACGATCAGCGATGAGTGGGACATTCCAGAGAAGCAGCCTTTCAAAGACCTG GGCAATTTGCGTTACTGGCTGGAAGAGGCAGAGTG

TAGAGATCAGTACAGTGTGATTTTTGAGAGCGGAGACCGGACGTCCATCTTCTGGAATGACGTCAAGGACCCAGTCTCAATTGAAGAAAGAGCG - UNI

7911 - AGATGGACAGAGACGTACGTGCGCTGGTCCCCTAAGGGTACCTACCTGGCCACTTTCCATCAGCGGGGTATCGCCCTCTGGGGAGGGGACAAG

TTCAAGCAGATTCAGAGGTTCAGCCACCAAGGCGTGCAGCTCATCGACTTCTCTCCGTGTGAAAG ATACTTGGTAACGTTCAGCCCTCTGATGGACACT

CAGGATGACCCTCAGGCCATCATCATCTGGGACATCCTCACGGGCCATAAGAAGAGAGGTTTTCACTGCGAAAGCTCAGCCCACTGGCCCATCTTCAA G

TGGAGCCATGATGGCAAATTCTTTGCAAGAATGACCCTGGATACTCTTAGCATCTATGAAACACCT - UNI10968 - TCCATGGGCCTTTTGGACAA

GAAGAGTTTGAAGATCTCTGGAATTAA - UNI11533 - AGACTTTTCTTGGTCTCCGGGTGGTAACATCATTGCTTTTTGGGTGCCTGAAGACAAAG

ATATTCCAGCCAGGGTGACCCTGATGCAGCTCCCCACCAGACAGGAGATCCGAGTGAGGAATTTGTTCAATGTGGTTGATTGCAAGCTGCACTGGCAGAA

AAATGGAGATTACCTATGTGTAAAAGTGGACAGGACTCCGAAAGGCACACAG GGAGTTGTCACAAATTTTGAAATATTCCGAATGAGGGAGAAGCAGGT

ACCTGTTGATGTTGTTGAGATGAAAG AAACCATCATAGCCTTTGCCTGGGAACCCAATGGCAGTAAGTTTGCCGTGCTTCATGGTGAGGCCCCTCGGAT

CTCTGTCTCCTTCTACCACGTGAAGAGCAACGGGAAGATTGAACTCATCA AGATGTTTGACAAGCAGCAAGCCAACACCATCTTCTGGAGTCCCCAGGG

GCAGTTCGTGGTGCTGGCCGGGCTGAGGAG CATGAACGGTGCCTTGGCGTTTGTCGACACTTCAGACTGCACCGTCATGAACATTGCAGAGCACTACAT

GGCCTCCGATGTTGAATGGGACCCAACTGGCCGCTACGTGGTTACCTCTGTGTCGTGGTGGAGCCACAAG - UNI8893 - GTGGACAATGCTTACTG

GCTGTGGACCTTCCAAGGTCGCCTTCTGCAGAAGAACAACAAGGACCGCTTCTGCCAGCTGCTCTGGAGACCAAGGCCCCCAACACTCCTCAGCCAGGAT

CAGATAAAG - UNI3810 - CAAATTAAAAAGGATCTGAAGAAGTACTCCAAGATCTTTGAGCAGAAGGATCGCTTGAGCCAGTCCAAAGCTTCAAAG

 - UNI37514 - GAACTGGTGGAAAGAAGGCGGACCATGATGGAGGACTTCCGGCAATACCGGAAAATGGCCCAGGAACTCTACATGAAGCAGAAGAA

CGAGCGTCTAGAGCTACGAGGAG - UNI27668 - GGGTGGACACTGACGAGCTGGACAGCAACGTGGATGACTGGGAGGAAGAGACCATTGAGTTT 

- UNI27668 - TGTCACCGAGGAAGTCATTCCTCTGGGAAGTCAGGAGTGATCTCAGCACTGTG - UNI16491 - TGTCACCGTGCCGTGCCCAG

GATCCGAGGCCACCCTTCACGGCGAGCCTCGTGCTGGGCTCTTACCTGTGCTTTCTTGCTCTGGACTGCGAGTGCACCCAGGGTTCTTCTATCCCGACAC

AGCTCTGTGCCTTCAGCCCCAGGTCCACAGCGGGGACACTCGAGCCTCTGCTCTCACCTTGCCCTGTTTGGGTTTTTATCAGCCGTGTCTGCATTGGAGC

CTCACTGCAGTGTTCCTGGTGGCTCCTCTTAACTCCTGCTGCTGTCCATGGGGTTTCCAGAGCCTTCACCTACAGCTCAGTGGGGTTTCCATTCACGGAC

TTGCTGTTCCTGTGGGCCAGTGTCGTGTGGCCTGGAGACCATCAGGAGTCTGCACACCCACCACTTACTTGTGCCAGAAACTCTGGAGGCACCCACACCT

CCCACCTGTTCAGGTTGTGGCAGCCTCTGTGCAGGTTGGATGTGGAAATAAAAGCAACCCTGTGTGA
Translation
MQDAENVAVPEAAEERAEPARQQPASESPPTDEAAGSGGSEVGQTEDAEEDAEAGPEPEVRAKPAAQSEEETATSPAASPTPQSAERSPSQEPSAPGKAE

AVGEQARGHPSAGAEEEGGSDGSAAEAEPRALENGEADEPSFSDPEDFVDDVSEEE - UNI5600 - - UNI6842 - ELLGDVLKDRPQEADGIDS

VIVVDNVPQVGPDRLEKLKNVIHKIFSKFGKIINDYYPEEDGKTKG GYIFLEYASPAHAVDAVKNADGYKLDKQHTFRVNLFTDFDK KYMTISDEWDI

PEKQPFKDL GNLRYWLEEAECRDQYSVIFESGDRTSIFWNDVKDPVSIEERA - UNI7911 - RWTETYVRWSPKGTYLATFHQRGIALWGGDKFKQ

IQRFSHQGVQLIDFSPCER RYLVTFSPLMDTQDDPQAIIIWDILTGHKKRGFHCESSAHWPIFK KWSHDGKFFARMTLDTLSIYETP - UNI10968

 - SMGLLDKKSLKISGIK - UNI11533 - KDFSWSPGGNIIAFWVPEDKDIPARVTLMQLPTRQEIRVRNLFNVVDCKLHWQKNGDYLCVKVDRTP

KGTQ GVVTNFEIFRMREKQVPVDVVEMKE ETIIAFAWEPNGSKFAVLHGEAPRISVSFYHVKSNGKIELIK KMFDKQQANTIFWSPQGQFVVLAGLR

S SMNGALAFVDTSDCTVMNIAEHYMASDVEWDPTGRYVVTSVSWWSHK - UNI8893 - VDNAYWLWTFQGRLLQKNNKDRFCQLLWRPRPPTLLSQ

DQIK - UNI3810 - QIKKDLKKYSKIFEQKDRLSQSKASK - UNI37514 - ELVERRRTMMEDFRQYRKMAQELYMKQKNERLELRGG - UNI

27668 - GVDTDELDSNVDDWEEETIEF - UNI27668 - CHRGSHSSGKSGVISALC - UNI16491 - CVTVPCPGSEATLHGEPRAGLLPVL

SCSGLRVHPGFFYPDTALCLQPQVHSGDTRASALTLPCLGFYQPCLHWSLTAVFLVAPLNSCCCPWGFQSLHLQLSGVSIHGLAVPVGQCRVAWRPSGVC

TPTTYLCQKLWRHPHLPPVQVVAASVQVGCGNKSNPV
Transcript ENSMUST00000100507
Sequence
GACTTCTGGGAGTCGGAAGCAGGGCGGCCGAGCCGGGTGAGAAGCAGCGCGGGCCCATGCAGGACGCTGAGAACGTGGCGGTGCCCGAGGCGGCCGAGGA

GCGGGCTGAGCCCGCGAGGCAGCAGCCGGCCTCCGAGTCGCCGCCGACGGACGAGGCGGCAGGGTCTGGGGGGTCCGAAGTGGGGCAGACGGAAGACGCC

GAAGAAGACGCCGAGGCCGGACCGGAGCCCGAAGTGAGGGCCAAGCCGGCGGCCCAATCCGAAGAGGAAACGGCGACGAGTCCGGCCGCCTCGCCCACGC

CGCAGTCGGCGGAGCGGTCCCCGTCGCAGGAGCCCTCTGCTCCCGGGAAGGCAGAGGCCGTTGGCGAGCAGGCCCGGGGGCACCCCTCGGCTGGAGCGGA

GGAGGAGGGCGGGTCTGATGGGAGCGCGGCTGAGGCGGAGCCGCGGGCTCTGGAGAACGGAGAGGCAGATGAGCCCTCCTTCAGCGACCCCGAGGATTTC

GTAGACGACGTGAGCGAGGAAG - UNI5600 - - UNI6842 - AACTACTTGGTGATGTACTCAAAGATCGGCCTCAGGAAGCGGACGGGATTGAC

TCGGTGATTGTTGTAGACAACGTCCCTCAGGTGGGGCCAGACCGACTTGAGAAACTCAAAAATGTCATCCACAAGATCTTCTCCAAGTTTGGGAAAATCA

TAAATGACTATTACCCTGAGGAGGACGGAAAGACGAAAGG GTACATCTTTCTGGAGTACGCTTCTCCCGCCCATGCTGTGGATGCTGTGAAAAACGCCG

ATGGCTACAAGCTGGACAAGCAGCACACGTTCCGGGTCAACCTCTTCACCGACTTTGACAA GTACATGACGATCAGCGATGAGTGGGACATTCCAGAGA

AGCAGCCTTTCAAAGACCTG GGCAATTTGCGTTACTGGCTGGAAGAGGCAGAGTGTAGAGATCAGTACAGTGTGATTTTTGAGAGCGGAGACCGGACGT

CCATCTTCTGGAATGACGTCAAGGACCCAGTCTCAATTGAAGAAAGAGCG - UNI7911 - AGATGGACAGAGACGTACGTGCGCTGGTCCCCTAAGG

GTACCTACCTGGCCACTTTCCATCAGCGGGGTATCGCCCTCTGGGGAGGGGACAAGTTCAAGCAGATTCAGAGGTTCAGCCACCAAGGCGTGCAGCTCAT

CGACTTCTCTCCGTGTGAAAG ATACTTGGTAACGTTCAGCCCTCTGATGGACACTCAGGATGACCCTCAGGCCATCATCATCTGGGACATCCTCACGGG

CCATAAGAAGAGAGGTTTTCACTGCGAAAGCTCAGCCCACTGGCCCATCTTCAA GTGGAGCCATGATGGCAAATTCTTTGCAAGAATGACCCTGGATAC

TCTTAGCATCTATGAAACACCT - UNI10968 - TCCATGGGCCTTTTGGACAAGAAGAGTTTGAAGATCTCTGGAATTAA - UNI11533 - AGA

CTTTTCTTGGTCTCCGGGTGGTAACATCATTGCTTTTTGGGTGCCTGAAGACAAAGATATTCCAGCCAGGGTGACCCTGATGCAGCTCCCCACCAGACAG

GAGATCCGAGTGAGGAATTTGTTCAATGTGGTTGATTGCAAGCTGCACTGGCAGAAAAATGGAGATTACCTATGTGTAAAAGTGGACAGGACTCCGAAAG

GCACACAG GGAGTTGTCACAAATTTTGAAATATTCCGAATGAGGGAGAAGCAGGTACCTGTTGATGTTGTTGAGATGAAAG AAACCATCATAGCCTTT

GCCTGGGAACCCAATGGCAGTAAGTTTGCCGTGCTTCATGGTGAGGCCCCTCGGATCTCTGTCTCCTTCTACCACGTGAAGAGCAACGGGAAGATTGAAC

TCATCA AGATGTTTGACAAGCAGCAAGCCAACACCATCTTCTGGAGTCCCCAGGGGCAGTTCGTGGTGCTGGCCGGGCTGAGGAG CATGAACGGTGCC

TTGGCGTTTGTCGACACTTCAGACTGCACCGTCATGAACATTGCAGAGCACTACATGGCCTCCGATGTTGAATGGGACCCAACTGGCCGCTACGTGGTTA

CCTCTGTGTCGTGGTGGAGCCACAAG - UNI8893 - GTGGACAATGCTTACTGGCTGTGGACCTTCCAAGGTCGCCTTCTGCAGAAGAACAACAAGG

ACCGCTTCTGCCAGCTGCTCTGGAGACCAAGGCCCCCAACACTCCTCAGCCAGGATCAGATAAAG - UNI3810 - CAAATTAAAAAGGATCTGAAGA

AGTACTCCAAGATCTTTGAGCAGAAGGATCGCTTGAGCCAGTCCAAAGCTTCAAAG - UNI37514 - GAACTGGTGGAAAGAAGGCGGACCATGATG

GAGGACTTCCGGCAATACCGGAAAATGGCCCAGGAACTCTACATGAAGCAGAAGAACGAGCGTCTAGAGCTACGAGGAG - UNI27668 - GGGTGGA

CACTGACGAGCTGGACAGCAACGTGGATGACTGGGAGGAAGAGACCATTGAGTTTTTTGTCACCGAGGAAGTCATTCCTCTGGGAAGTCAGGAGTGATCT

CAGCACTGTG - UNI16491 - TGTCACCGTGCCGTGCCCAGGATCCGAGGCCACCCTTCACGGCGAGCCTCGTGCTGGGCTCTTACCTGTGCTTTCT

TGCTCTGGACTGCGAGTGCACCCAGGGTTCTTCTATCCCGACACAGCTCTGTGCCTTCAGCCCCAGGTCCACAGCGGGGACACTCGAGCCTCTGCTCTCA

CCTTGCCCTGTTTGGGTTTTTATCAGCCGTGTCTGCATTGGAGCCTCACTGCAGTGTTCCTGGTGGCTCCTCTTAACTCCTGCTGCTGTCCATGGGGTTT

CCAGAGCCTTCACCTACAGCTCAGTGGGGTTTCCATTCACGGACTTGCTGTTCCTGTGGGCCAGTGTCGTGTGGCCTGGAGACCATCAGGAGTCTGCACA

CCCACCACTTACTTGTGCCAGAAACTCTGGAGGCACCCACACCTCCCACCTGTTCAGGTTGTGGCAGCCTCTGTGCAGGTTGGATGTGGAAATAAAAGCA

ACCCTGTGT
Translation
MQDAENVAVPEAAEERAEPARQQPASESPPTDEAAGSGGSEVGQTEDAEEDAEAGPEPEVRAKPAAQSEEETATSPAASPTPQSAERSPSQEPSAPGKAE

AVGEQARGHPSAGAEEEGGSDGSAAEAEPRALENGEADEPSFSDPEDFVDDVSEEE - UNI5600 - - UNI6842 - ELLGDVLKDRPQEADGIDS

VIVVDNVPQVGPDRLEKLKNVIHKIFSKFGKIINDYYPEEDGKTKG GYIFLEYASPAHAVDAVKNADGYKLDKQHTFRVNLFTDFDK KYMTISDEWDI

PEKQPFKDL GNLRYWLEEAECRDQYSVIFESGDRTSIFWNDVKDPVSIEERA - UNI7911 - RWTETYVRWSPKGTYLATFHQRGIALWGGDKFKQ

IQRFSHQGVQLIDFSPCER RYLVTFSPLMDTQDDPQAIIIWDILTGHKKRGFHCESSAHWPIFK KWSHDGKFFARMTLDTLSIYETP - UNI10968

 - SMGLLDKKSLKISGIK - UNI11533 - KDFSWSPGGNIIAFWVPEDKDIPARVTLMQLPTRQEIRVRNLFNVVDCKLHWQKNGDYLCVKVDRTP

KGTQ GVVTNFEIFRMREKQVPVDVVEMKE ETIIAFAWEPNGSKFAVLHGEAPRISVSFYHVKSNGKIELIK KMFDKQQANTIFWSPQGQFVVLAGLR

S SMNGALAFVDTSDCTVMNIAEHYMASDVEWDPTGRYVVTSVSWWSHK - UNI8893 - VDNAYWLWTFQGRLLQKNNKDRFCQLLWRPRPPTLLSQ

DQIK - UNI3810 - QIKKDLKKYSKIFEQKDRLSQSKASK - UNI37514 - ELVERRRTMMEDFRQYRKMAQELYMKQKNERLELRGG - UNI

27668 - GVDTDELDSNVDDWEEETIEFFVTEEVIPLGSQE - UNI16491 - 

For any suggestions or comments, please send an email to unitrap@crg.es