Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000056131 (Pgm3)
Chromosomal location
Chr 9: 86446083 - 86465434 (-)
Description
phosphoglucomutase 3 Gene [Source:MGI Symbol;Acc:MGI:97566]
RefSeq_dna
NM_028352 
RefSeq_peptide
NP_082628.2 
UniGene
Mm.390201 
MGI
MGI:97566 
Uniprot/SWISSPROT
Q9CYR6 
Uniprot/SPTREMBL
Q8BWW3 B2RS40 Q3TFH8 Q3U5N1 Q8BLS4 Q8BME1 Q8BZ65 
Human Ortholog
ENSG00000013375 (PGM3)
Omim not available
UniTrap UNI11033
Vector Insertion
Chr 9: 86459339 - 86461115
Public Clones W037B08 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 31% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI38038
Vector Insertion
Chr 9: 86458283 - 86459339
Public Clones (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 39% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI4465
Vector Insertion
Chr 9: 86452116 - 86453021
Public Clones AA0272 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 75% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000072585
Sequence
GCTGGGCCACGTCTGCGAGGTCTGAGAGAGTTGGTTTGGTGCGCACTGCGCGGCCGCGTCTCGCCTGTGGAGAGAACGTTCTTGCTCCAGATCTAG GCA

TGGATCTGGAGGCTGTGTGTAAGCGCTCGGCACTCCATGCCAAGCCCCAGGGGCTCATTCTTCAGTATGGGACTGCTGGATTTCGGACCAATGCCCAGCA

TCTCGATCATATCATGTTTCGAATGGGATTGCTAGCTGTCCTGCGGTCAAAGCAAACAAGATCTACCATTGGAGTCATGGTTACGGCCTCACATAACCCT

GAG GAAGACAATGGTGTGAAATTGGTTGATCCTTTGGGGGAAATGTTGGCCCCTTCCTGGGAGGAGCATGCCACCTGTCTGGCCAGTGCGGAGGAGCAG

GACGTGCGGCAAGTGCTTGCTGCCATCGTGGAGAAAGAAGCTGTGGATCTGACACAGACCGCCTTCGTAGTCATTGCCAGAGACACCAG GCCCAGCAGT

GAGAAACTTTCACAATCTGTGATAGATGGCGTGACTGTTTTAGGAGGTCAATTCCATG - UNI11033 - ATTACGGCCTGTTGACGACACCTCAGTT

GCACTACATGGTGTATTGCCGGAATTCCGGAGGCCGGTATGGACAGGCCACCGTAGAAGGCTACTGCCAGAAGCTCTCCAAGGCTTTCGTAGACCTTACG

AATCAG GTTTCCTGCAGTGGAGATGTAAAGAGGTCAGTTAAGGTTGACTGTGCCAACGGCATAGGGGCCTTGAAGCTAAGAGAAATGGAACACTACTTC

TCCCGGGGCCTGTCGGTTCTGCTGTTTAATGATGGGACCCAAGGGCGGCTCAATCACCTGTGCGGTGCTGACTTTGTGAAAAGTCAACAGAAACCCCCAC

AGG GAATTGAAATGAAGTCCGGTGAGAGATGCTGCTCCTTCGATGGGGATGCGGACAGGATCGTGTATTACTACTGTGATGCAGATGGTCACTTTCATC

TCATAGATGGAGACAAGATAGCGACGTTAATTAGCAGTTTCCTTAAAGAGCTACTGTTGGAG ATTGGAGAAAGTGTGAACCTCGGAGTCGTACAGACAG

CATATGCAAATGGAAGTTCCACGCGGTACCTTGAAGAAGTTATGAAG GTACCTGTGTATTGCACCAAAACTGGTGTTAAACATTTGCATCACAAGGCTC

AAGAGTTTGACATCGGAGTTTATTTTGAAGCGAACGGGCATGGAACA - UNI4465 - GCACTGTTCAGTGAAGCAGTTGAAGTGAAGATAAAAAGAC

TAGCCCAAGAACTAGACGATGGAAAAGGAAAAGCAGCCAGGACGCTTGCGAGCATCATCGACTTATTCAACCAG GTCGCGGACAGGAGAGTTATTAGCA

CCACGGATGCTGAGAGACAAGCAGTCACTCCACCAGGACTCCAAGAGGCAATCAATGACCTGGTGAAGAAATACACACTTGCCCGAGCTTTTGTACGGCC

CTCTGGTACTGAAGACATTGTCCGAGTATATGCAGAAGCCAACTCACAA GAAAGCGCAGACAGGCTTGCCTATGAAGTGAGTTTGCTGGTGTTCCAGCT

GGCTGGAGGCATTGGAGAAAGACCACAACCAACTTTCTGAAGATAAATTTTATATTCTGGAGAAGTGGACTTCTAAAATGTTTCTATAACACTTTATAAT

ATTGGCAGTACTAGGGCATTTGTAATCATGACATCAACATGTCATGCATGTTAATGGATTATTTCTAGATAGGTTTTTAAATGCTACCAGGAAAAAAATG

TTTAGAAGCTCAAAATCTTAGACTTGGGAATGAAGCTTACCTCTGATTTTAATCTGTATTAAGTTTTAATAGTTCAAGTGTCATTAATTTTACAGGGTAT

GAAGTGAATTCATGAAGGGTACTGGGAAATTAAACTTTACTAACTTCTTTGC
Translation
 MDLEAVCKRSALHAKPQGLILQYGTAGFRTNAQHLDHIMFRMGLLAVLRSKQTRSTIGVMVTASHNPE EDNGVKLVDPLGEMLAPSWEEHATCLASAE

EQDVRQVLAAIVEKEAVDLTQTAFVVIARDTR RPSSEKLSQSVIDGVTVLGGQFHD - UNI11033 - DYGLLTTPQLHYMVYCRNSGGRYGQATVE

GYCQKLSKAFVDLTNQ VSCSGDVKRSVKVDCANGIGALKLREMEHYFSRGLSVLLFNDGTQGRLNHLCGADFVKSQQKPPQG GIEMKSGERCCSFDGD

ADRIVYYYCDADGHFHLIDGDKIATLISSFLKELLLE IGESVNLGVVQTAYANGSSTRYLEEVMK VPVYCTKTGVKHLHHKAQEFDIGVYFEANGHGT

 - UNI4465 - ALFSEAVEVKIKRLAQELDDGKGKAARTLASIIDLFNQ VADRRVISTTDAERQAVTPPGLQEAINDLVKKYTLARAFVRPSGTEDI

VRVYAEANSQ ESADRLAYEVSLLVFQLAGGIGERPQPTF
Transcript ENSMUST00000070064
Sequence
AAGCTGGGCCACGTCTGCGAGGTCTGAGAGAGTTGGTTTGGTGCGCACTGCGCGGCCGCGTCTCGCCTGTGGAGAGAACGTTCTTGCTCCAGATCTAG G

CATGGATCTGGAGGCTGTGTGTAAGCGCTCGGCACTCCATGCCAAGCCCCAGGGGCTCATTCTTCAGTATGGGACTGCTGGATTTCGGACCAATGCCCAG

CATCTCGATCATATCATGTTTCGAATGGGATTGCTAGCTGTCCTGCGGTCAAAGCAAACAAGATCTACCATTGGAGTCATGGTTACGGCCTCACATAACC

CTGAG GAAGACAATGGTGTGAAATTGGTTGATCCTTTGGGGGAAATGTTGGCCCCTTCCTGGGAGGAGCATGCCACCTGTCTGGCCAGTGCGGAGGAGC

AGGACGTGCGGCAAGTGCTTGCTGCCATCGTGGAGAAAGAAGCTGTGGATCTGACACAGACCGCCTTCGTAGTCATTGCCAGAGACACCAG GCCCAGCA

GTGAGAAACTTTCACAATCTGTGATAGATGGCGTGACTGTTTTAGGAGGTCAATTCCATG - UNI11033 - ATTACGGCCTGTTGACGACACCTCAG

TTGCACTACATGGTGTATTGCCGGAATTCCGGAGGCCGGTATGGACAGGCCACCGTAGAAGGCTACTGCCAGAAGCTCTCCAAGGCTTTCGTAGACCTTA

CGAATCAG GTTTCCTGCAGTGGAGATGTAAAGAGGTCAGTTAAGGTTGACTGTGCCAACGGCATAGGGGCCTTGAAGCTAAGAGAAATGGAACACTACT

TCTCCCGGGGCCTGTCGGTTCTGCTGTTTAATGATGGGACCCAAGGGCGGCTCAATCACCTGTGCGGTGCTGACTTTGTGAAAAGTCAACAGAAACCCCC

ACAGG GAATTGAAATGAAGTCCGGTGAGAGATGCTGCTCCTTCGATGGGGATGCGGACAGGATCGTGTATTACTACTGTGATGCAGATGGTCACTTTCA

TCTCATAGATGGAGACAAGATAGCGACGTTAATTAGCAGTTTCCTTAAAGAGCTACTGTTGGAG ATTGGAGAAAGTGTGAACCTCGGAGTCGTACAGAC

AGCATATGCAAATGGAAGTTCCACGCGGTACCTTGAAGAAGTTATGAAG GTACCTGTGTATTGCACCAAAACTGGTGTTAAACATTTGCATCACAAGGC

TCAAGAGTTTGACATCGGAGTTTATTTTGAAGCGAACGGGCATGGAACA - UNI4465 - GCACTGTTCAGTGAAGCAGTTGAAGTGAAGATAAAAAG

ACTAGCCCAAGAACTAGACGATGGAAAAGGAAAAGCAGCCAGGACGCTTGCGAGCATCATCGACTTATTCAACCAG GCAGCTGGAGATGCTATTTCTGA

CATGTTGGTGATTGAGGCTATCCTGGCTCTGAAGGGGCTGACTGTACAGCAGTGGGATGCTATTTATGTCGATCTTCCTAACAGACAACTCAAAGTTAAG

 GTCGCGGACAGGAGAGTTATTAGCACCACGGATGCTGAGAGACAAGCAGTCACTCCACCAGGACTCCAAGAGGCAATCAATGACCTGGTGAAGAAATAC

ACACTTGCCCGAGCTTTTGTACGGCCCTCTGGTACTGAAGACATTGTCCGAGTATATGCAGAAGCCAACTCACAA GAAAGCGCAGACAGGCTTGCCTAT

GAAGTGAGTTTGCTGGTGTTCCAGCTGGCTGGAGGCATTGGAGAAAGACCACAACCAACTTTCTGAAGATAAATTTTATATTCTGGAGAAGTGGACTTCT

AAAATGTTTCTATAACACTTTATAATATTGGCAGTACTAGGGCATTTGTAATCATGACATCAACATGTCATGCATGTTAATGGATTATTTCTAGATAGGT

TTTTAAATGCTACCAGGAAAAAAATGTTTAGAAGCTCAAAATCTTAGACTTGGGAATGAAGCTTACCTCTGATTTTAATCTGTATTAAGTTTTAATAGTT

CAAGTGTCATTAATTTTACAGGGTATGAAGTGAATTCATGAAGGGTACTGGGAAATTAAACTTTACTAACTTCTTTGCAGCCCCTTTCGATTGCTTACCT

AACCAAGATGTTTTGTAGCACTGACCTACCTGGTTCAAATGGGGAGATTTCGTATGAACCAATTTCCCATGCGGATCTCAATGTGAGGAAGAAATGACTG

ACTGGTTTGCTTAGCAGCATCAGAACTGGCAGGTGGCCCATCTTTCATTGTACTGGCAGAGCTCTGTGCTGTGCCCACTAGAGTGTGTGGTCCAGGCTTC

AGCTACTCTTTAGTGCTCAGCGAAGGGACACAGCTCCATCTGATACCTGAAGCCTCTGACAACCAAGTGACCATTCTGATACTAGGACATTATTAACCAC

AGAAAGAAGAAAAACAACAATTAACAATTAAATGAGGCTTGAGACCAAGCAGGAAAAAAGAAAACGTGGTGTGTATTTTGCAGGTTTAAGACAACCCAAG

ACAGTGAAACAATGGACTATATATGCAAATATAGACCTTGTAGGCACCATCATCAGTATGAGCCACCTATATATTTAAACTTGATTCAGGCCACATTCAG

ACATAAGCTCTTATTTACAAATATTTAAATTAAATACAACCTGAATAATGCTTTGTTACATATACACATATATATATATATAAAAGAAAAAGAAACTATA

CAACTCAGCAGTGTGTTTTAAGTATTCCATTTAGGCTCTGGAGAACCACTGGTGGTGGTCAAGTCTTTATGACTCCTTCTAGAAAGTCCTTTTCTATCAT

CTCTTCAATTTTTTGCCTGGCTTTGCTGGAAAAGGCTTTGTGATTCTCCAGTTTCATGTCCTTGTTTGGGAAGGAGTTTGGGTAGAGGACGGGGCTCCCT

GAGTGTCCGCCACAGCGGCTTGTGACTTTGCTGTTGAAGACTTGGCTGAGGACATTGAAGAAAGGCAGAAGCTGCTCCATGTTGCGCATGGTGCAGAGCG

TCAGCAGCAAGTGCCCTGGCTCCCAGCCCAGTGTCCTCCCCGAGCAGTCTTCCTCTGGGTTTTTCTGCAAAACACAAAAAGGAGTTGTTACTAATAGGTA

ACGTATGTTATGTGAGAAGTGGAGACAAATGCCAGCATCAAGTCTTCACTGCAGACTTGACGAAGTCCACTGGTTCTGAAGCCTTTTAGCCGCCAATCTA

AATGAAAAGTTAACCATGGACTTTCATTATTAACAAATGCTGTCACACAGTTTACCATATTGCCTCTAGTCTCCTAAAAATCAAACCAAATCAAATCAAT

TTATCCTGAAAGAAAGTAAATGATGCTTACAGCCTTTATAGCTAATTTTGAAATACAAGACAATCATGGTAAAATTACTTTTTATATTCCTATGGAGATT

TTTCCTTTAAAAGTGTGACCCTTCCCTCACAGCCCTGAGCTCTTAACCAAGAAAAGCACAGTTTCAGTGGTCTTTTGTTCTTATGTACCTGCCCTCCATA

CTAAATAACCAAATATCTCCATATGACCATTTCCTCCTCTGACTTCACAAGTCTACAGGTGTGTGCCTTCCTTCCTGTTTACCTGTCATTGCTTTTGCTG

CCATATCATATGCATCAATAGCCACCCTCACCTGATGCTTGGCCATCTCCAATCCCTCCAAAATCTTAAAGTCCTCCTCGTCCTGTGGAAGGAAAGAGGA

GAACTCATAGCCCCTGTTCGAGTAACAAGTGTGTTTGGCCATGAAGGCCTTGTTTAAAGGGATGGGGATGGGAGATCCTTTCTGGTGCAGATGGCTGCCG

TATCTGTGGTCATTGTGGAGGACAGCAGAGGGCACAGGCCTACAGTCGTATGAATGGTCACTGTATCTGCATTTCCTCCTCAAATCCTGTGACAAAAAAG

GAATGCTTTTGTCCTTAAGTCCTGGATGGACTTTTGGTCCATAACTTTGTCCTTTTATTTGGCTCCTAAAGAAGCAAGTTCCTCATGTCCTTTAAGTAAA

GCTCCTAATTGCTTTCTTCCCTTTTGCTCTGTAGAGAATCGAGTACAGCTTCATTACTGCTGAAACAAATCGTGTGAGTTCACACAGACCTGGTCTCACA

TGAGCCCTAACTCTATGTACTGTTAAGATTCTGCACTTAGACAGGTATTAACACAGGCCCAATGGTGAAATGCCATTTTCATTTACCCCTCTGCTTCAGG

GCCAAGATTGGCCCGAAGGTTAGCCTGATCCTTACTTAATTATAAAGGATTCAAGGCATGTATAAACTACAGAATTTAACTTCTACACTTTATTCATGAG

ACAGATTTTGGTAATTCTCATTTTCTCTTGATTTCCTTTATATAGATGGTTTTTTAAAAAATGTTTTAGACATTTGTATTTTTGAGTTCTTCCACTAACT

TTCTGATTAGTAGTCACATTTAGTAGATGGCTTTATTCTCAGCAGTGTTTCTAAAACTACAGGGAGCAGCAGTAGGGTGGATATGCAAAACTGAAACATG

GCATAACAAGAGTTTTATAGAAAATATTAGGAAATATTATTAAAGAAGTCTATCTAGCTAATTCAATTTTGATAAAGTATTTCTGTCAAGTTTATTGAAA

CTTT
Translation
 MDLEAVCKRSALHAKPQGLILQYGTAGFRTNAQHLDHIMFRMGLLAVLRSKQTRSTIGVMVTASHNPE EDNGVKLVDPLGEMLAPSWEEHATCLASAE

EQDVRQVLAAIVEKEAVDLTQTAFVVIARDTR RPSSEKLSQSVIDGVTVLGGQFHD - UNI11033 - DYGLLTTPQLHYMVYCRNSGGRYGQATVE

GYCQKLSKAFVDLTNQ VSCSGDVKRSVKVDCANGIGALKLREMEHYFSRGLSVLLFNDGTQGRLNHLCGADFVKSQQKPPQG GIEMKSGERCCSFDGD

ADRIVYYYCDADGHFHLIDGDKIATLISSFLKELLLE IGESVNLGVVQTAYANGSSTRYLEEVMK VPVYCTKTGVKHLHHKAQEFDIGVYFEANGHGT

 - UNI4465 - ALFSEAVEVKIKRLAQELDDGKGKAARTLASIIDLFNQ AAGDAISDMLVIEAILALKGLTVQQWDAIYVDLPNRQLKVK VADRRV

ISTTDAERQAVTPPGLQEAINDLVKKYTLARAFVRPSGTEDIVRVYAEANSQ ESADRLAYEVSLLVFQLAGGIGERPQPTF

For any suggestions or comments, please send an email to unitrap@crg.es