Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000056234 (AC154532.3-202)
Chromosomal location
Chr 14: 32973169 - 32992438 (+)
Description
nuclear receptor coactivator 4  [Source:RefSeq peptide;Acc:NP_001029160]
RefSeq_peptide
NP_062718.2 NP_001029160.1 
UniGene
Mm.470621 Mm.473298 
Uniprot/SPTREMBL
Q3UI10 Q3UJ26 Q3UJ63 Q3UKL9 Q5U4H9 Q8BSH1 Q9CUF2 Q9CXF3 Q9WV42 
Human Ortholog
ENSG00000138293 (NCOA4)
Omim 188550 - THYROID CARCINOMA, PAPILLARY  
UniTrap UNI10778
Vector Insertion
Chr 14: 32973197 - 32983933
Public Clones (sanger) P106D01 (ggtc) 3SP141F10 (ggtc) 3SE028G09 (ggtc) P110B03 (ggtc)
5SE078E04 (ggtc) 5SP106D01 (ggtc) 5SE032G10 (ggtc) P141F10 (ggtc)
3SE112D05 (ggtc) 5SP125H05 (ggtc) Q008E04 (ggtc) 5SE077E05 (ggtc)
5SP141F10 (ggtc) 5SE032G09 (ggtc) P082B06 (ggtc) 3SE087D12 (ggtc)
3SP125H05 (ggtc) 3SE064H08 (ggtc) CMHD-GT_262G2-3 (cmhd) CMHD-GT_524B4-5S (cmhd)
CMHD-GT_320G2-3 (cmhd) CMHD-GT_524B4-3 (cmhd) IST12965D5 (tigm) IST11742G8 (tigm)
IST10053H9 (tigm) IST14157E9 (tigm) IST10758F9 (tigm) IST14172E8 (tigm)
IST10073D10 (tigm)
Private Clones OST462051 (lexicon) OST413593 (lexicon) OST325401 (lexicon) OST319054 (lexicon)
OST305507 (lexicon) OST292838 (lexicon) OST286765 (lexicon) OST278286 (lexicon)
OST248284 (lexicon) OST237118 (lexicon) OST232362 (lexicon) OST222104 (lexicon)
OST210133 (lexicon) OST205234 (lexicon) OST204605 (lexicon) OST199058 (lexicon)
OST151041 (lexicon) OST149639 (lexicon) OST148374 (lexicon) OST67778 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI25148
Vector Insertion
Chr 14: 32984089 - 32985488
Public Clones not available
Private Clones OST193935 (lexicon)
Severity of mutation (?) Insertion after 8% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI18219
Vector Insertion
Chr 14: 32990560 - 32991008
Public Clones not available
Private Clones OST427309 (lexicon)
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000111994
Sequence
GGATCACCGGAAGGAGCGCTGCCAGCCG - UNI10778 - GAACAGTGAGCAGAATGAACACATCCCTGGAACAGAGTGGCTGCTACAGTAATAGAGA

AACTCTTCTGAGGTGCAGTGATGCAAGGAGGGAGCTGGAGCTTGCTATTGGTGGAGTACTTCGGGCTGAACAGCAAATTAAAGATAATTTACGAGAG - 

UNI25148 - GTAAAAGCTCAGATTCACAGCTGCATAAGTCGCCACCTGGAATGCCTTCGGAGCCGAGAGGTGTGGCTCAATGAACAGGTCGATCTCAT

CTATCAGCTTAAAGAGGAGACACTGCAGCAGCAGGCTCAGCAGCTCTATTGG CTAATGGGCCAATTCAATTGTCTTATTCATCAACTGGAGTATACTCA

GAACAAAGATCTTGCCAATCAAGTCTCTGTGTGCTTGGAGAG ACTGGGCAGTTTGGCCCTGAAGCCTGAAGATTCAACTGTCCTACTCTTTGAAGCAGA

TACATCTGCTCTGCGCCAGACCATCACCACATTTGGATCCCTTAAGACCATT CAAATCCCTGAGCATCTGATGGCTCACGCGAGCTCCTCAAGTATTGG

GCCTTTCCTAGAGAAAAGAGGCTATATCCAGGTGCCAGAGCAG AAGTCAGCATCCAGTGGCACAGCTGTATCTCTGAGTGAGTGGCTTCTTGTAAGCAA

ACCTGCCATTGGTCTTCAGGCTCCTTATGTACCCAGTACCAACCCACAGGACTGGCTTATCCCAAAACAGACTTCAGAGAATAGTCAG ACTTCTGCCAG

AGCCTGCAGTTTCTTCAGCGATGCCTGGGGCAATCTGAAGGGCTTAGAAAATTGGCTCCTTAACAGTCATCAACAAGAAATTGCTGGAAAACCAAGTTCC

TCAAAATGTAACAGCCATTGTAGCACCAGTTCTTTCTCTCCTGAAGCTGAAAAGGCTGAAGATGTAGAGCTCCTTGATCAAGACGAGCTGGACCTGTCTG

ATTGGTTGGTGACTCCTCAGGAACCCTGTGAGCTGGAGAAGCCTGTGGATGGCAGCTGGGAAACCAGCGAGAAGTTTAAACTCTTGTTCCAGGTGTTCAG

AGAGCCCTACAATGTGAGTGATTGGCTTGTCAAGCCTGACTCCTGTACCAACTGTCAGGGCAACCAGCCTAGAGGTGTGGAGATTGAGAACCTGGGCAAT

CTGAAATGCCTAAATGACCACTTGGAGGCCAAAAAATCAGTGTCGGTCCCCGGCGCAACAATCAGCGACGGCTGGCTTGCCCAGAACCATCAGGACACAT

GGAAAGTAGAGGAAGTGTGTAAAGCCAACGAGCCCTGCACCAGTTTTGCAGAGTGTGTGTGTGATGACAACTGTGAGAAGGAAGCCATGTATAAATGGCT

TCTGAAGAAGGGAGGAAAGGACAAGAATGGAATGCCTATGGAACCTAAATCTGAGCCTGAGAAACACAGAGAGTCCCTGACACTGTGGCTCTGCCCTTCC

AGAAATGAGCTAACAGAACAAGCTAAGGCACCCAAGGCTATGGCTCCTGCTAGAATTGCTGATTCCTTCCACGTCATAAAGAATAGTTCCTTGTCAGAGT

GGCTTATGGGGCCTACGTGCAAAGGAGGCCCTAAGGACGTGCCTAATACAGAGGAGAGAGCTGGCAAAGAGATGCTTCAAAGCTCCATGGCCACTTCCTG

GTGTCCCTTTAACACTGCCGACTGGGTTTTACCAGGAAAGAAAGTGGGAAGCCTCAGCCAGTTCCCCTCTGGAGAAGATAAGTGGCTACTTCGAAAGAAG

GCACAG GAAGCATTTCTTAATTCACCCCTACAAGAAGAACGTAACTTTCGCCCCGACTGTTACGGCCTCCCAGCAGTTTGTGATCTCTTTGCCTGTATG

CAGCTTAAGGTTGATAAAGAAAAATGGCTGTACAGAACTCCTCTACAG - UNI18219 - ATGTGAAGGAACAGACTACCAGAATCGAGCAGCTTTCC

TGCAGATTATTGCACATCCTTGAGCTGAGTGACTGCGATTTGCCAAACCATTGTGCATTCCAAGCCTGACTAGTCAGCTTAGTTCCTCTCCTGCTTAGTT

TTGAACTAGTAAACAGAAGTCATAAACTATGAGTTAAGTCTGTGAAAGAGGCTTCAAGTGGAGGTGATTCATTCTTTTGAAAGCCGTAACGTGCGTAACT

TGATCAACTCCCGTACTAGAAACCACATCCCGGTACACAGGCCTTTACCAGCTTTTCTACAGCCAACACTAGTTTTAAAAGTGAAATATTCCTATATCAA

GTGTGTTAATGTGTTCAAGGTAATAAGTTCTCTAACATTTGTCTTTTAGCTGTTTCTCATTACAGGCTTCTAGAGATTTGAAAATTTTTTTTGTTCAGTT

GATATATAGAATATTTCACACAAATAGTTAACCTTGCCAATACAGTATATTTTTCCCTACTAAATGTCTATTAGTTATATTGCAAATTTTGATACTCATC

AGATATTTAGCCTACATACCATTTCTAACATTTCTCATTTGGAAGAAATTAAGCTATTATAGTTGTTGCCTTTATTTCTTTCCAGTATCCAGTGAGCTCT

TTGAAAGGGACTTTGTTTTAAGACCACTCTTAGGGCAGTCAGAGCTCTTAAAGTCCTACAAACCTCGGCTTTAACTAAAGTGAACCCTAAAGCAGAAAGG

TAAAAAGTGTTAGGAATGCAGTACCCGAACCACTGGTCATCCTAAGGATTTCTTGGTGCATCCTGTGTAAATGGAAGCTGAGCTTGACACCTGGTGCTCT

TAACTAGGGATAAAGTCAATGTCCTGTTACTTCAAGCACAGCATCCTGAACCTCCTAAAGTACAGTGCAGTGACATCTTGATTACCAGGCTGTGCTCAAC

ACTGTGCCTTGGAGTGTCTCACCGAGACTTCACAGAACTGATATCCTTGAGTTCTGTATTCTAGAAAGCTTCTCTAAGGATTTATCTTTTACAGTTCCCA

AGGATAAATTAGTTGCTTTCTATTCTTTGAACTATTAATATTAAGCCTCTGAAATGCCTATGCTATTGGAAGTACTTTTGGGAAAATTTTATGGTCCCAT

AGTGACATTACCATACAGCTTTACTGAAGCTCCAAATCATAGCTGAAAAGAACCTCATATTTTCTTATGTCCCTCAAGATGCCACTGAGTATTATAAAGT

TGGTAGGTAAAGACAATTTAAGGAGCCTTTCCAACATTTTAGGTTGCAGGGAACTTTGTAGTTTCTTTTTTGAGGTCTAACACTGTATTCACATTATTAA

AACATAATTTAAGTTAATCACTTGCTAATGATATATAAAACTTTCTTTTGCATTAAGTTTTAAATCTCCATTAAAAGCATAATGGACACATC
Translation
 - UNI10778 - MNTSLEQSGCYSNRETLLRCSDARRELELAIGGVLRAEQQIKDNLRE - UNI25148 - VKAQIHSCISRHLECLRSREVWLNE

QVDLIYQLKEETLQQQAQQLYW LMGQFNCLIHQLEYTQNKDLANQVSVCLER RLGSLALKPEDSTVLLFEADTSALRQTITTFGSLKTI QIPEHLMA

HASSSSIGPFLEKRGYIQVPEQ KSASSGTAVSLSEWLLVSKPAIGLQAPYVPSTNPQDWLIPKQTSENSQ TSARACSFFSDAWGNLKGLENWLLNSHQ

QEIAGKPSSSKCNSHCSTSSFSPEAEKAEDVELLDQDELDLSDWLVTPQEPCELEKPVDGSWETSEKFKLLFQVFREPYNVSDWLVKPDSCTNCQGNQPR

GVEIENLGNLKCLNDHLEAKKSVSVPGATISDGWLAQNHQDTWKVEEVCKANEPCTSFAECVCDDNCEKEAMYKWLLKKGGKDKNGMPMEPKSEPEKHRE

SLTLWLCPSRNELTEQAKAPKAMAPARIADSFHVIKNSSLSEWLMGPTCKGGPKDVPNTEERAGKEMLQSSMATSWCPFNTADWVLPGKKVGSLSQFPSG

EDKWLLRKKAQ EAFLNSPLQEERNFRPDCYGLPAVCDLFACMQLKVDKEKWLYRTPLQ - UNI18219 - M

For any suggestions or comments, please send an email to unitrap@crg.es