Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000056268 (Dennd1b)
Chromosomal location
Chr 1: 140860363 - 141068489 (+)
Description
DENN/MADD domain containing 1B Gene [Source:MGI Symbol;Acc:MGI:2447812]
RefSeq_dna
NM_181347 NM_183217 
RefSeq_peptide
NP_851992.1 
MGI
MGI:2447812 
Uniprot/SPTREMBL
B2X2E2 B2RUR7 
Human Ortholog
ENSG00000162701 (DENND1B)
Omim not available
UniTrap UNI1470
Vector Insertion
Chr 1: 141040578 - 141064247
Public Clones CD0442 (sanger) RRF437 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 59% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000071518
Sequence
ATGGTTTTGTTCATTTCCATCACCTGTTTGTATGTTTTTTCCTCTTTTTCTGTAAGGACTTCTACCTGTTTGATTATGTTTTCCTGTTTTTCTTTAAGGA

CTTGTAACTCTTTAGCAGTGTTCTCCTGTATTTCTTTAAGTGATTTATTAAAGTCCTTCTTGATGTCCTCTACCATCATCATGAGATATGCTTTTAAATC

TAGGTCTAGGTTCTCAG CTTCCCTAAAGTTGAGAGCACATCTGATTACAATGTTTGCCTGGAGTTTCCTGCACAGAATTCTGCCTATG TTTATTGATG

GTCGACTGGCAAAGCTTAACGCAGGAAGAGGTTTCTCTGATATCTTCGAAGAAGAGATCACTTCGGGTGGCTTCTGTGGAG GGAGCCCGAGGTCATATC

AGCAGTGGGTGTATACAGTCAAG AAAGGAGGTGCATTGTTCAACACAGCAGTGACCAAAGCAACTCCCGCTGTGCGGACTGCATACAAATTT GCAAAG

AGTCACGCCAGACTGGGACTAAAGGAGGTGAAGAGCAGGCTGAAACACAAG GACAATGAGGAAGAGTATGGGACCTGTTCTGGTTTGGTGCAGTATACA

CCAGTGTACACTTTACACAATGAAAAGGGAGAGAACAGAGAGAAGCACAAGCTTTCCCAG - UNI1470 - ACACACTTGAAAAGGCCTCATAAGAGC

CTAGATGGTACCCTGTATGATGATGATGATGATGACGATGACATTGAACGGGCAAGCAA GATATCTTCTGAAGACGGGGAAGAAACCCGTGCTTATTTC

TACGAAAGCGATGACTCCGTTGAAGCCCAGGTGAAGGCTCCTTACTCAGGGGAGATGGACTTACTGGGTGAGATCCTGGACACGCTGAGCACGCACAGCT

CTGATCAAGGAAAGCTGGCGCCTGCCAAGAGCCTGGATTTCTTCAGATCCATGGATGACATTGATTACAAGCCTACG AACAAGTCCAACGCTCCCAGTG

AGAATAACCTGGCCCTGCTGTGTGCTTCTGGAGACCAGGGAGAGTGGAATCTCGGGCAGGACGACAGCGCCCTCCATGGCAGGCAACTCCCTCCATCCCC

AAGGAAACGCGTTTCCTCTGGTGGGCTGACAGAGTCTCTGTTTATCCTGAAAGAGGAGAGCAGGGAGAAGCCCCTCTGTGCTGACAGCGTAAGTGGCCCT

ACTGTGGTGGGAAAGCCAGCTCCGACTTCAGGACTGCGTTCCCAGCCTGCTGCTCCTGAAGCTTCCCAAACAGAGAGAGGAAGAGCAGAAGTGAAGCAAA

CACCAGGTCAGGCTCCACTTCAGTCAGAGGATCTGTCGGTGCCCGGCCCCGGGAGCCGCCAGTCGACTTTTGTTCCCTGGGAGAAGGCTGGCAAAGAGGA

CACGAAGCCTTCAAAGGATGTCGGACTTCTCCAAGAAGTAGTGTCATTGTGTCACATGTCATGTGACTTCCAACAAGATTTAAACATTTCAGAAGAAAGC

AGAAGTGGAAACCAAACTTAGGTACCAGTAGTGGGTCAGTTGCTTGCCTCTTGGCTTCTCCGGAGGCATGTGGAATTCCTTCCCTGAGATGGGAACAGTA

GAGTCACTGATAGGAATGGCGACCCCTACTGCAGTCTAGTTGGTTTCCCTGTCTGTTCATCTCATGGATCTGTATTACCTGTTGGTTTCCCAGCGTAAAA

CGAATTCTGCTGTGCTGTTAAATCAGGTACTAACTTGTACATAGGCTGAAAGTGTGTTTTGAATTTAAGCTTTCCCAGTATTTGGTGCTTAATGCTGTTT

GTTTTATTTAAACTAAGTGTGCGTATATAACCCCACATATCGCCAGTAGTTACTGTACTAACCTGGCTGAGCATGAACTGATCAAGATGTCAAAACTGAT

GGAAAATAGCCTGACACTGATGAAACTGTTAACCCACTAATTGCCTTAATCTTCCAGTTATGCTAAACATACAGATGACGCGTGATGCAAAGCTTGAAAG

AGGAGTTATCTTGTCCTGCAGAGCAGTGATGCCTTTTTCTACCATGAACTAAGCTCACCATTCTTTTCCAGTTTCAATGCACTCTAGCAGAAATAATTTG

CTTTTTATGAAGACATGTAGCCATGTTTTCCAAGCAACGTGAATGTGTATATTTACCTTTCAGTGAACTATATTAAGTGCTGACTTACAATGTGAAGTTA

AAAGCTTCTGCTTACAAAGAAGCCCCTCAATGGTCGATCTCATGTATGTGTTAACCATGGTTCACCGCCCGAAAGCCAAATGCCCTGCAGAGTCCAGATA

GGCTGTTGTCCTCTTCTCTTAACTGACGTGCTGTGAAGATGCTCATAGCCTTACCTTGTGTTTGCTTTTTTAAAGAATTAACTTTGTATTTTAAATGTTC

TTCTAGATTTGTAGAAAAAATGCAAAGATGGTACTGAGTTGCTCTCTGCCCTGGACCCTGTCTCTGCTGTTGTTAGCATCCTATGTTAGTGTGCTGCATT

TGCCCTATCATTGACTCGCTGTGTGGTAGTCAGAGCTCTGACTGTTCCCTGCTGTCCCCTTTCTGTTCCCTTATCGCCTCAGCGTTCTAGAGTATGTTCT

ACGATCATGTCTTCTGAGGTTCCTCCTCACCCTGGGACTTCACTTTCTTAGTTTGATGGCTTTGAAGTTATCAGGAATATTGTTCAGATGTCCAGCTCCT

GTACTGTATATAGTATTTTTCTCCTTATTACACCGAGGTTATCCAGCTTTGAGGGAGGAGATCACAGAAGAAAAGTGCCGTTTTCAGCATCTGAAGGGGT

GTGCTGCAAGCATATGCCATGTTGTGTTGACTTTGAACACCTGCTGGGGTTCTCTATTCTGAGTGTGTCCCCTGCAGGCAAGCAGGAGGGGTGCAGGCAA

AGAAGAGAGGAAGGGCAGGCACAATAGAATTATTTAGGGCAGAGAAGTATCAAAATGCATCCTTTGTGATTCTCCGTGGATCCTGCCTCCCTCATGATTA

CTCTAGCTTTGGAGCACACCTGAGAGCACATGCAGATCCCTAGATGTGCAGGTAGTGTGTTTGAACACGCCATGGTTCTAGTCTATACATCCTCAAGTGT

GATGATTACTTTTCAAAAATTGTCTTTTTTTAGTG
Translation
MVLFISITCLYVFSSFSVRTSTCLIMFSCFSLRTCNSLAVFSCISLSDLLKSFLMSSTIIMRYAFKSRSRFSA ASLKLRAHLITMFAWSFLHRILPM F

IDGRLAKLNAGRGFSDIFEEEITSGGFCGG GSPRSYQQWVYTVK KGGALFNTAVTKATPAVRTAYKF AKSHARLGLKEVKSRLKHK DNEEEYGTCS

GLVQYTPVYTLHNEKGENREKHKLSQ - UNI1470 - THLKRPHKSLDGTLYDDDDDDDDIERASK KISSEDGEETRAYFYESDDSVEAQVKAPYSG

EMDLLGEILDTLSTHSSDQGKLAPAKSLDFFRSMDDIDYKPT NKSNAPSENNLALLCASGDQGEWNLGQDDSALHGRQLPPSPRKRVSSGGLTESLFIL

KEESREKPLCADSVSGPTVVGKPAPTSGLRSQPAAPEASQTERGRAEVKQTPGQAPLQSEDLSVPGPGSRQSTFVPWEKAGKEDTKPSKDVGLLQEVVSL

CHMSCDFQQDLNISEESRSGNQT
Transcript ENSMUST00000094505
Sequence
ATCTCGCCTTGTGGCTGCTGTAAAGTCAGTGCTTTCCAGGGACGTCTTCATTTGTATTTTAGCAGTTTATATGGTCTGGCAAAGTGGGACATATCATAAA

TGGACAAG ATCCTGAGGTATTGTGGAAATTCCCAGAGGACTTTGGAGACCAG GAAGTTCTGCAGAGCGTGCCCAAGTTCTGTTTTCCCTTCGATGTGG

AAAG GGTGTCTCAGAATCAAGTTGGACAGCACTTTACCTTCGTCCTGACAGACATGGAAAGTAAGCAGCGATTTGGGTTCTGCAGGCTCACATCTGGAG

GCAGAATTTGTTTATGTATTCTTAG TTACTTGCCATGGTTTGAAGTATATTATAAACTTCTAAATACTCTGGCAGATTACTTGGCCAAGGAACTG GAA

GAGGATTTGAATGAAACTCTTAAATCACTCTATAACCACCCAGTACCAAAGGCAAACACTCCTGTCAACTTGAGTGTG CACTCCTGTTTCATCACACCT

GACATAACTGGACTCCCAACGATACCGGAGAGT AGAAACCTGACCGAGTACTTTGTTGCCGTGGATGTCAACAACATGCTGCGACTGTACGCCAGCATG

CTGCATGAGAGGCGCATCATTATTACCTCGAGCAAATTAAGCACT TTAACTGCCTGTCTCCATGGATCGGCTGCGCTACTCTACCCGATGTACTGGCAA

CACATATATATCCCCGTGCTTCCTCCACACCTGCTGGACTACTGCTG TGCCCCAATGCCATACCTGATTGGAATACACTCCAGTCTCATAGAG AGAGT

GAAAAATAAATCATTGGAAGATGTGGTTGTGTTAAATGTTGACACAAACACGTTAGAATCACCATTTAATGACTTGAGCAGCCTGCCCAGTGATGTG GT

CTCGGCCTTGAAAAATAAGCTGAAGAAGCAGTCCACAGCTACGGGAGATGGAGTGGCTCGGGCCTTTCTGAGGGCTCAGGCGGCTTTGTTTGGCTCCTAC

CGAGATGCTCTGAGATACAAGCCT GGCGAGCCCATCACCTTCTGTGAGGAGAGCTTTGTAAAGCACCGCTCAAGCGTGATGAAACAGTTCCTGGAGACT

GCAGTTAACCTTCAGCTCTTTAAGCAG TTTATTGATGGTCGACTGGCAAAGCTTAACGCAGGAAGAGGTTTCTCTGATATCTTCGAAGAAGAGATCACT

TCGGGTGGCTTCTGTGGAG GGAGCCCGAGGTCATATCAGCAGTGGGTGTATACAGTCAAG AAAGGAGGTGCATTGTTCAACACAGCAGTGACCAAAGC

AACTCCCGCTGTGCGGACTGCATACAAATTT GCAAAGAGTCACGCCAGACTGGGACTAAAGGAGGTGAAGAGCAGGCTGAAACACAAG GACAATGAGG

AAGAGTATGGGACCTGTTCTGGTTTGGTGCAGTATACACCAGTGTACACTTTACACAATGAAAAGGGAGAGAACAGAGAGAAGCACAAGCTTTCCCAG -

 UNI1470 - ACACACTTGAAAAGGCCTCATAAGAGCCTAGATGGTACCCTGTATGATGATGATGATGATGACGATGACATTGAACGGGCAAGCAA GA

TATCTTCTGAAGACGGGGAAGAAACCCGTGCTTATTTCTACGAAAGCGATGACTCCGTTGAAGCCCAGGTGAAGGCTCCTTACTCAGGGGAGATGGACTT

ACTGGGTGAGATCCTGGACACGCTGAGCACGCACAGCTCTGATCAAGGAAAGCTGGCGCCTGCCAAGAGCCTGGATTTCTTCAGATCCATGGATGACATT

GATTACAAGCCTACG AACAAGTCCAACGCTCCCAGTGAGAATAACCTGGCCCTGCTGTGTGCTTCTGGAGACCAGGGAGAGTGGAATCTCGGGCAGGAC

GACAGCGCCCTCCATGGCAGGCAACTCCCTCCATCCCCAAGGAAACGCGTTTCCTCTGGTGGGCTGACAGAGTCTCTGTTTATCCTGAAAGAGGAGAGCA

GGGAGAAGCCCCTCTGTGCTGACAGCGTAAGTGGCCCTACTGTGGTGGGAAAGCCAGCTCCGACTTCAGGACTGCGTTCCCAGCCTGCTGCTCCTGAAGC

TTCCCAAACAGAGAGAGGAAGAGCAGAAGTGAAGCAAACACCAGGTCAGGCTCCACTTCAGTCAGAGGATCTGTCGGTGCCCGGCCCCGGGAGCCGCCAG

TCGACTTTTGTTCCCTGGGAGAAGGCTGGCAAAGAGGACACGAAGCCTTCAAAGGATGTCGGACTTCTCCAAGAAGTAGTGTCATTGTGTCACATGTCAT

GTGACTTCCAACAAGATTTAAACATTTCAGAAGAAAGCAGAAGTGGAAACCAAACTTAGGTACCAGTAGTGGGTCAGTTGCTTGCCTCTTGGCTTCTCCG

GAGGCATGTGGAATTCCTTCCCTGAGATGGGAACAGTAGAGTCACTGATAGGAATGGCGACCCCTACTGCAGTCTAGTTGGTTTCCCTGTCTGTTCATCT

CATGGATCTGTATTACCTGTTGGTTTCCCAGCGTAAAACGAATTCTGCTGTGCTGTTAAATCAGGTACTAACTTGTACATAGGCTGAAAGTGTGTTTTGA

ATTTAAGCTTTCCCAGTATTTGGTGCTTAATGCTGTTTGTTTTATTTAAACTAAGTGTGCGTATATAACCCCACATATCGCCAGTAGTTACTGTACTAAC

CTGGCTGAGCATGAACTGATCAAGATGTCAAAACTGATGGAAAATAGCCTGACACTGATGAAACTGTTAACCCACTAATTGCCTTAATCTTCCAGTTATG

CTAAACATACAGATGACGCGTGATGCAAAGCTTGAAAGAGGAGTTATCTTGTCCTGCAGAGCAGTGATGCCTTTTTCTACCATGAACTAAGCTCACCATT

CTTTTCCAGTTTCAATGCACTCTAGCAGAAATAATTTGCTTTTTATGAAGACATGTAGCCATGTTTTCCAAGCAACGTGAATGTGTATATTTACCTTTCA

GTGAACTATATTAAGTGCTGACTTACAATGTGAAGTTAAAAGCTTCTGCTTACAAAGAAGCCCCTCAATGGTCGATCTCATGTATGTGTTAACCATGGTT

CACCGCCCGAAAGCCAAATGCCCTGCAGAGTCCAGATAGGCTGTTGTCCTCTTCTCTTAACTGACGTGCTGTGAAGATGCTCATAGCCTTACCTTGTGTT

TGCTTTTTTAAAGAATTAACTTTGTATTTTAAATGTTCTTCTAGATTTGTAGAAAAAATGCAAAGATGGTACTGAGTTGCTCTCTGCCCTGGACCCTGTC

TCTGCTGTTGTTAGCATCCTATGTTAGTGTGCTGCATTTGCCCTATCATTGACTCGCTGTGTGGTAGTCAGAGCTCTGACTGTTCCCTGCTGTCCCCTTT

CTGTTCCCTTATCGCCTCAGCGTTCTAGAGTATGTTCTACGATCATGTCTTCTGAGGTTCCTCCTCACCCTGGGACTTCACTTTCTTAGTTTGATGGCTT

TGAAGTTATCAGGAATATTGTTCAGATGTCCAGCTCCTGTACTGTATATAGTATTTTTCTCCTTATTACACCGAGGTTATCCAGCTTTGAGGGAGGAGAT

CACAGAAGAAAAGTGCCGTTTTCAGCATCTGAAGGGGTGTGCTGCAAGCATATGCCATGTTGTGTTGACTTTGAACACCTGCTGGGGTTCTCTATTCTGA

GTGTGTCCCCTGCAGGCAAGCAGGAGGGGTGCAGGCAAAGAAGAGAGGAAGGGCAGGCACAATAGAATTATTTAGGGCAGAGAAGTATCAAAATGCATCC

TTTGTGATTCTCCGTGGATCCTGCCTCCCTCATGATTACTCTAGCTTTGGAGCACACCTGAGAGCACATGCAGATCCCTAGATGTGCAGGTAGTGTGTTT

GAACACGCCATGGTTCTAGTCTATACATCCTCAAGTGTGATGATTACTTTTCAAAAATTGTCTTTTTTTAGTG
Translation
   MESKQRFGFCRLTSGGRICLCILS SYLPWFEVYYKLLNTLADYLAKEL EEDLNETLKSLYNHPVPKANTPVNLSV HSCFITPDITGLPTIPES 

RNLTEYFVAVDVNNMLRLYASMLHERRIIITSSKLST LTACLHGSAALLYPMYWQHIYIPVLPPHLLDYCC CAPMPYLIGIHSSLIE RVKNKSLEDV

VVLNVDTNTLESPFNDLSSLPSDV VSALKNKLKKQSTATGDGVARAFLRAQAALFGSYRDALRYKP GEPITFCEESFVKHRSSVMKQFLETAVNLQLF

KQ FIDGRLAKLNAGRGFSDIFEEEITSGGFCGG GSPRSYQQWVYTVK KGGALFNTAVTKATPAVRTAYKF AKSHARLGLKEVKSRLKHK DNEEEY

GTCSGLVQYTPVYTLHNEKGENREKHKLSQ - UNI1470 - THLKRPHKSLDGTLYDDDDDDDDIERASK KISSEDGEETRAYFYESDDSVEAQVKA

PYSGEMDLLGEILDTLSTHSSDQGKLAPAKSLDFFRSMDDIDYKPT NKSNAPSENNLALLCASGDQGEWNLGQDDSALHGRQLPPSPRKRVSSGGLTES

LFILKEESREKPLCADSVSGPTVVGKPAPTSGLRSQPAAPEASQTERGRAEVKQTPGQAPLQSEDLSVPGPGSRQSTFVPWEKAGKEDTKPSKDVGLLQE

VVSLCHMSCDFQQDLNISEESRSGNQT
Transcript ENSMUST00000070283
Sequence
GCCGCCGCTCGGAGCAGCGCGTCCCGGACGGCGTGCGGGCGTGCGGGCGCGGGGCGACGGCAGCCCCGCAGCGACATGTGACCATGGACCGCAGGACCAG

 GGAAAATCCAGAAAGAACTTTTGACTTGGTATTGAAAGTGAAGTGTCATGCCTCTGAAAATGAAG ATCCTGAGGTATTGTGGAAATTCCCAGAGGACT

TTGGAGACCAG GAAGTTCTGCAGAGCGTGCCCAAGTTCTGTTTTCCCTTCGATGTGGAAAG GGTGTCTCAGAATCAAGTTGGACAGCACTTTACCTTC

GTCCTGACAGACATGGAAAGTAAGCAGCGATTTGGGTTCTGCAGGCTCACATCTGGAGGCAGAATTTGTTTATGTATTCTTAG TTACTTGCCATGGTTT

GAAGTATATTATAAACTTCTAAATACTCTGGCAGATTACTTGGCCAAGGAACTG GAAGAGGATTTGAATGAAACTCTTAAATCACTCTATAACCACCCA

GTACCAAAGGCAAACACTCCTGTCAACTTGAGTGTG AACCAAGAGCTATTTATTGCCAGTGAGCAAGTTCTGAAAGATGACCCCTCACTAATTCCG CA

CTCCTGTTTCATCACACCTGACATAACTGGACTCCCAACGATACCGGAGAGT AGAAACCTGACCGAGTACTTTGTTGCCGTGGATGTCAACAACATGCT

GCGACTGTACGCCAGCATGCTGCATGAGAGGCGCATCATTATTACCTCGAGCAAATTAAGCACTGTAAGTCCTTCACACTTGCGCCTTTGACTAACACAT

ATTGAGTGCTTCACAAAAAGACCTAAACACGTCTGCACATTTAGAACTGTGCTCTGTGTACTTAAAAGACAATATCTACATATTTTTAATATATGGTTTT

TATCTGGCTCTTGAAGTATAAAGGCCTGATTTAAAGAAAGCTTCGCAGATGCATTAAGTCAAGTTAATTATTTTTCCTTATCAAGAGAAAAGGTGGGTTT

TTTTCCCCCCTTTTAAACTCTCTGGAGTTCATTTTAGTACCTTGATCATGTAGAGAACTCTTAAGAGCTATTATGAGATCTTTATTATTCACTTGTAGCT

TTTTCCATTGGAGCTACTTGAATGACACTGTGGGCCATGATAATAGCTGCTCCTAACCAGGTAATAGCAGATTCATCTTTGTCGCCTCGCAGGGCCTAGG

AGGGAATCCTATAATAGTTCTGGTTTGGAGGAGCTCTTCAGGCTGATAATAACTTAAAAGTCAAAGTAGCATTTTTATCAATTGCGGGTTTTATGGCACT

TAGTCTGATATTCTCCTGGAAGGTCTTCATTACTGTGAAAAAGGCAAGAATACAAGGGCTTTCTCAGGCTATAGAAGAGGACTCAAAAGTATTTGCTAGT

ATTCATATTTTCAGTTCATATTTTTTCATTAAACATAAAATTTGAGTAGTTTTGAATTCAAAATATGTAAAATAATTCAAGGTATTTGAATAAACTGTGA

TATATT
Translation
MDRRTR RENPERTFDLVLKVKCHASENED DPEVLWKFPEDFGDQ EVLQSVPKFCFPFDVER RVSQNQVGQHFTFVLTDMESKQRFGFCRLTSGGRI

CLCILS SYLPWFEVYYKLLNTLADYLAKEL EEDLNETLKSLYNHPVPKANTPVNLSV NQELFIASEQVLKDDPSLIP HSCFITPDITGLPTIPES 

RNLTEYFVAVDVNNMLRLYASMLHERRIIITSSKLSTVSPSHLRL

For any suggestions or comments, please send an email to unitrap@crg.es