Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000056296 (Synpr)
Chromosomal location
Chr 14: 14117294 - 14447973 (+)
Description
synaptoporin Gene [Source:MGI (curated);Acc:Synpr-001]
RefSeq_dna
NM_028052 
RefSeq_peptide
NP_082328.2 
UniGene
Mm.473151 
MGI
MGI:1919253 
Uniprot/SWISSPROT
Q8BGN8 
Human Ortholog
ENSG00000163630 (SYNPR)
Omim not available
UniTrap UNI32229
Vector Insertion
Chr 14: 14117721 - 14286570
Public Clones IST11993C3 (tigm) IST12560H7 (tigm) IST13291A11 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI33950
Vector Insertion
Chr 14: 14395631 - 14441083
Public Clones IST14367E8 (tigm) IST14185G10 (tigm) IST13652C8 (tigm) IST14790E6 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 44% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000112656
Sequence
AGCAAGGGAGTATCAGGTTCCTGTAGTCAGCTGTGGGCTGTCACTGTCTACTAATATGACTGTCTTCCCATCTCTCTGCAAGAAGGCAGAAGCTGCTATC

TGATTGGTATAGCATCTGACTTTCCCTCTGCATTGATTTCTTGTCCTTTTCCTTTGCTTCATAAAGAGAGGGACAAGAGCTGGTGCTGTGGACAGAGAAG

CTTCATTTTTAGTATGAGACAACCTCTTTATTTTTTCAGGAGAGGGAAGTTGGATTATCAATTCTTTTGTAAATGTGTATGGTGATATTTGCTCCG CTT

TTTGCAATGTTTGCATTTGCAACATGTGGTGGCTATTCAGGAGGCCTGCGGCTGAGTGTGGACTGTGTCAATAAGACAGAAAGTAACCTCAGCATTGACA

TAGCGTTTGCGTACCCATTCAG GCTGCAACAGGTGACCTTTGAAGTGCCCACCTGTGAGGGAAAGGAACAGCAGAAGCTGGCATTGGTTGGAGACTCCT

CATCCTCAGCAGAATTCTTTGTCACCGTGGCTGTGTTCGCCTTTCTCTACTCCCTGGCTGCCACGGTCGTGTACATTTTCTTCCAGAACAAGTACCGCGA

AAACAACCGGGGCCCACTCATT - UNI33950 - GACTTTATCGTCACTGTAGTCTTTTCATTCTTGTGGCTGGTGGGTTCCTCTGCTTGGGCAAAAG

GACTGTCTGATGTCAAAGTGGCAACAGATCCCAAAGAAGTCCTGTTGCTGATGTCAGCTTGCAAGCAGCCTTCCAACAAGTGCATGGCTGTCCACAGCCC

TGTCATGTCCAGCTTAAACACATCTGTG GTCTTCGGGTTTTTGAATTTTATCCTCTGGGCTGGAAACATTTGGTTTGTTTTCAAGGAGACTGGCTGGCA

TTCCTCTGGACAGAGATACCTTTCAGACCCCATGGAGAAGCACTCCAGCAGCTACAATCAAGGACGCTACAACCAAGAGAGTTATGGGTCAAGTGGTGGG

TACAGCCAGCAGGCGAATCTGGGGCCAACTTCCGATGAGTTTGGCCAACAGCCTAGTGGTCCCACTTCCTTTAACAATCAGATATAACGGAGTATCACCC

AAATTCTTCTGGTGATAGCATCACCACCCTCCATTTCAGTAGCAGAAGAATTTTTAAGAGTTTCAATCAATTATTAATGTAGAGAATGTTGAATGTAAAT

CAGAGATCTGTAGTCCTCATTAAGACACAAAGGCCTGGGTGGTGATAAATGGTACTTAGAGATGAGATGTCATAAGGAGATAAATTATTCATCACAGATG

GGTAATTAGAAAGTATCTTGTTATATACACAGACACTTTTATGGTCGTTTTGTATTGTGGTAAAAATAGTAGAAGCATTTGTAGCTTAAAGTCTCTAGTA

TGTAATGTGCATAGATTACCTTAAATAGTATACAGTTTTCGTATGTGTTTTGATGCAACAAATATTTTACTGATTTCTAGATGACTATTTGATGAATCAC

ATCATGCATGCATTACTATTTTTTAGTTTAGGCCTTTTAGAACTGTAACTCTGTTTTGATAATTATTCTCTATTGTTTTCACTTGATAAAACAATGTTTA

TATGATTTCATGCATGAATAAGTATTTTCTCACAGAATGTTTGGCTGTATTTCTGGAGACATTTCAGTTTGCATCATGAGTTTGTTAAGCAAGTATTTAA

AGACATGTATGCATGTCTTTCTAGACTTTGCAAGTTTGTCACTCTGACTTTACCCAAGTTCTGAATGCATTAGAGCTAAAGTCTGGGAGCTTTCCCTATT

TGTCAATAGTGTTCTGTAAGGTGACTGCTCAACACTTCTCTGATTTATTTAAGTAAATATTTACATTCTTGTAACTTTCTATGCAGTTTCGTGTATCTTA

TCTTACGAGCCATGACTGATAACGTCCAATGACCCTGTGCTTGTAGAGTGGCGTTTTCTTTGCATCCAGAGAGGCAGATTTAGACACCATAGTTTAAGTA

GTATTAAGAAATGAGCTATGCTGTTTTATGTGACCAAATGAACGTTTGTTTAGTTTTGTTTATTTTTGAAGCTAATATGTTGTTCATTCTAATTTTAGAA

ATCTCATGTTATAGCTTAACAGAATTACTAATTTCGATTTGCTTATACATAGATTAATAATGGCTTCTCTATGTCACTCTATTCCCAAAGAGGGTTCTCA

TGAAACTCTCCACAGAACATATTCATTATTAAGAAGAAACCAATCTTCGTTTCTTCATTTTAACTCAATTGAAATAAGAATGCCCAACAGGAAGGGCAAG

CTAAACATCTGTGCTTCTAGATAAAGTTGTAACTGATGTGCAAATTGTATGTGTGATCTGTGATGTTGAAAGCAGTTTAGCACAAAATAGGCTGTCTTAA

ATACTATCTGTAACTAGTTTCTTAAATCCTATTGTTTATTAAATCCTGTACTGTGATATC
Translation
MCMVIFAP LFAMFAFATCGGYSGGLRLSVDCVNKTESNLSIDIAFAYPFR RLQQVTFEVPTCEGKEQQKLALVGDSSSSAEFFVTVAVFAFLYSLAAT

VVYIFFQNKYRENNRGPLI - UNI33950 - DFIVTVVFSFLWLVGSSAWAKGLSDVKVATDPKEVLLLMSACKQPSNKCMAVHSPVMSSLNTSV VF

GFLNFILWAGNIWFVFKETGWHSSGQRYLSDPMEKHSSSYNQGRYNQESYGSSGGYSQQANLGPTSDEFGQQPSGPTSFNNQI
Transcript ENSMUST00000070323
Sequence
TCTAGCTCGGCTTGCCTCCCGCACAGCGCTCTACACTGACTGAGCCACAGCGAGCTGGAACCTACAGCCGGCGCTCCCCACTCACCCCGGGTCCCGGGTG

AGCCGCTCACCACCAGAAGTGGCTTCTGACCCTGGGGAGCGTAGGTCAGAGGAACTTCATTCCTGAAGGGAACTGGTTCGAGAGAAGACAGAGTACGGGA

GAGCCATGGACCCTGTGAGCCAG GTGGCCTCTGCGGGCACCTTTCGGGCATTGAAGGAACCCCTTGCCTTCCTGCGAGCTCTGGAGTTG - UNI3222

9 - CTTTTTGCAATGTTTGCATTTGCAACATGTGGTGGCTATTCAGGAGGCCTGCGGCTGAGTGTGGACTGTGTCAATAAGACAGAAAGTAACCTCAGC

ATTGACATAGCGTTTGCGTACCCATTCAG GCTGCAACAGGTGACCTTTGAAGTGCCCACCTGTGAGGGAAAGGAACAGCAGAAGCTGGCATTGGTTGGA

GACTCCTCATCCTCAGCAGAATTCTTTGTCACCGTGGCTGTGTTCGCCTTTCTCTACTCCCTGGCTGCCACGGTCGTGTACATTTTCTTCCAGAACAAGT

ACCGCGAAAACAACCGGGGCCCACTCATT - UNI33950 - GACTTTATCGTCACTGTAGTCTTTTCATTCTTGTGGCTGGTGGGTTCCTCTGCTTGG

GCAAAAGGACTGTCTGATGTCAAAGTGGCAACAGATCCCAAAGAAGTCCTGTTGCTGATGTCAGCTTGCAAGCAGCCTTCCAACAAGTGCATGGCTGTCC

ACAGCCCTGTCATGTCCAGCTTAAACACATCTGTG GTCTTCGGGTTTTTGAATTTTATCCTCTGGGCTGGAAACATTTGGTTTGTTTTCAAGGAGACTG

GCTGGCATTCCTCTGGACAGAGATACCTTTCAGACCCCATGGAGAAGCACTCCAGCAGCTACAATCAAGGACGCTACAACCAAGAGAGTTATGGGTCAAG

TGGTGGGTACAGCCAGCAGGCGAATCTGGGGCCAACTTCCGATGAGTTTGGCCAACAGCCTAGTGGTCCCACTTCCTTTAACAATCAGATATAACGGAGT

ATCACCCAAATTCTTCTGGTGATAGCATCACCACCCTCCATTTCAGTAGCAGAAGAATTTTTAAGAGTTTCAATCAATTATTAATGTAGAGAATGTTGAA

TGTAAATCAGAGATCTGTAGTCCTCATTAAGACACAAAGGCCTGGGTGGTGATAAATGGTACTTAGAGATGAGATGTCATAAGGAGATAAATTATTCATC

ACAGATGGGTAATTAGAAAGTATCTTGTTATATACACAGACACTTTTATGGTCGTTTTGTATTGTGGTAAAAATAGTAGAAGCATTTGTAGCTTAAAGTC

TCTAGTATGTAATGTGCATAGATTACCTTAAATAGTATACAGTTTTCGTATGTGTTTTGATGCAACAAATATTTTACTGATTTCTAGATGACTATTTGAT

GAATCACATCATGCATGCATTACTATTTTTTAGTTTAGGCCTTTTAGAACTGTAACTCTGTTTTGATAATTATTCTCTATTGTTTTCACTTGATAAAACA

ATGTTTATATGATTTCATGCATGAATAAGTATTTTCTCACAGAATGTTTGGCTGTATTTCTGGAGACATTTCAGTTTGCATCATGAGTTTGTTAAGCAAG

TATTTAAAGACATGTATGCATGTCTTTCTAGACTTTGCAAGTTTGTCACTCTGACTTTACCCAAGTTCTGAATGCATTAGAGCTAAAGTCTGGGAGCTTT

CCCTATTTGTCAATAGTGTTCTGTAAGGTGACTGCTCAACACTTCTCTGATTTATTTAAGTAAATATTTACATTCTTGTAACTTTCTATGCAGTTTCGTG

TATCTTATCTTACGAGCCATGACTGATAACGTCCAATGACCCTGTGCTTGTAGAGTGGCGTTTTCTTTGCATCCAGAGAGGCAGATTTAGACACCATAGT

TTAAGTAGTATTAAGAAATGAGCTATGCTGTTTTATGTGACCAAATGAACGTTTGTTTAGTTTTGTTTATTTTTGAAGCTAATATGTTGTTCATTCTAAT

TTTAGAAATCTCATGTTATAGCTTAACAGAATTACTAATTTCGATTTGCTTATACATAGATTAATAATGGCTTCTCTATGTCACTCTATTCCCAAAGAGG

GTTCTCATGAAACTCTCCACAGAACATATTCATTATTAAGAAGAAACCAATCTTCGTTTCTTCATTTTAACTCAATTGAAATAAGAATGCCCAACAGGAA

GGGCAAGCTAAACATCTGTGCTTCTAGATAAAGTTGTAACTGATGTGCAAATTGTATGTGTGATCTGTGATGTTGAAAGCAGTTTAGCACAAAATAGGCT

GTCTTAAATACTATCTGTAACTAGTTTCTTAAATCCTATTGTTTATTAAATCCTGTACTGTGATATCTATTTGACCTCAATAAAGTTATTGCATACAAAC

TGACTGAACAATGAAGAATCATAACTATAGGGCCCTGTTGGCTTTAATCATGAGAGAATAAAGGTTAAATGC
Translation
MDPVSQ VASAGTFRALKEPLAFLRALEL - UNI32229 - LFAMFAFATCGGYSGGLRLSVDCVNKTESNLSIDIAFAYPFR RLQQVTFEVPTCEG

KEQQKLALVGDSSSSAEFFVTVAVFAFLYSLAATVVYIFFQNKYRENNRGPLI - UNI33950 - DFIVTVVFSFLWLVGSSAWAKGLSDVKVATDPK

EVLLLMSACKQPSNKCMAVHSPVMSSLNTSV VFGFLNFILWAGNIWFVFKETGWHSSGQRYLSDPMEKHSSSYNQGRYNQESYGSSGGYSQQANLGPTS

DEFGQQPSGPTSFNNQI

For any suggestions or comments, please send an email to unitrap@crg.es