Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000056367 (Actr3b)
Chromosomal location
Chr 5: 25265817 - 25356155 (+)
Description
ARP3 actin-related protein 3 homolog B (yeast) Gene [Source:MGI Symbol;Acc:MGI:2661120]
RefSeq_dna
NM_001004365 
RefSeq_peptide
NP_001004365.1 
UniGene
Mm.452858 Mm.150319 
MGI
MGI:2661120 
Uniprot/SWISSPROT
Q641P0 
Human Ortholog
ENSG00000133627 (ACTR3B)
Omim not available
UniTrap UNI37645
Vector Insertion
Chr 5: 25265947 - 25304263
Public Clones (cmhd)
Private Clones not available
Severity of mutation (?) Insertion after 4% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000088244
Sequence
GCACTGGGCACCCAGGGGCACGCTGGGGCTGGTGGGGACGGAGCGCCTCGTGGCCGAGCATGGCGGGCTCGCTGCCTCCCTGCGTGGTTGACTGCGGCAC

CGG - UNI37645 - GTACACCAAGCTTGGCTACGCAGGCAACACTGAACCACAGTTCATTATCCCGTCAT GTATCGCCATCCGAGAATCTGCAAAG

GTAGTTGATCAAGCCCAAAGGAGGGTGTTGAGAGGAGTCGATGACCTTGATTTCTTCATAGGGGATGAAGCCATTGATAAACCTACCTACGCTACCAAG 

TGGCCTATACGACATGGCATCGTTGAAGACTGGGATCTTATGGAAAGGTTCATGGAACAAGTGGTCTTTAAGTATCTTCGTGCTGAACCTGAGGACCACT

ACTTTTTAATG ACAGAACCTCCACTGAACACACCAGAAAACAGAGAGTACCTTGCAGAAATCATGTTTGAATCATTTAATGTACCAGGACTCTACATTG

CAGTACAG GCAGTGCTGGCTCTGGCAGCCTCTTGGACATCCCGGCAAGTTGGTGAACGCACACTAACGGGGATAGTTATAGACAGTGGAGACGGTGTCA

CCCATGTTATCCCGGTG GCAGAAGGTTATGTAATTGGAAGCTGCATCAAACACATCCCAATTGCAGGTAGAGATATTACGTATTTCATTCAACAGCTGC

TAAGGGAGAGGGAGGTGGGAATCCCTCCTGAGCAGTCACTGGAAACCGCAAAAGCCATCAAG GAGAAGTACTGCTACATTTGCCCGGATATTGTCAGAG

AATTTGCTAAGTATGACGTAGATCCTCGGAAGTGGATCAAACAGTACACAGGGATCAATGCCATCAACCAGAAGAAGTTCATTATAGATGTTGGTTATGA

AAGGTTCCTGGGACCAGAAATATTCTTTCACCCTGAG TTTGCCAACCCAGACTTTATGGAGTCCATCTCGGATGTTGTCGATGAAGTCATACAGAGCTG

TCCCATAGATGTGCGCCGGCCGCTGTATAAG AACGTCGTTCTTTCTGGAGGCTCCACAATGTTCAGAGATTTTGGACGTCGTCTGCAGAGAGATTTGAA

AAGAGTGGTGGACGCCAGGTTAAAGCTGAGCCAAGAGCTCAGTGGAGGCAGGATAAAG CCTAAACCTGTGGAGGTGCAGGTGGTCACGCACCACATGCA

GCGCTATGCCGTGTGGTTTGGAGGCTCGATGCTAGCCTCAACT CCGGAGTTCTTTCAGGTCTGTCACACCAAGAAGGACTATGAGGAATACGGCCCAAG

CATCTGCCGCCACAACCCTGTCTTCGGAGTCATGTCCTAGTGTCTGCGTTGGAGCCATTGTCTGACAAGTGTCCTGTTGGGGAATAAGTGTCCTTCAGAA

CCCAGAGCAGCCACGGCTCCTGTACATAGCAGTGTGGAATGGGTGTGTGAGCAGCGTGCTTTCATCGCCAGTGGGGCCAGGCACGGTCTTCCCAGTAAAG

CCATTTATCCGGTACGACTGTTCGTGGTCCTCCTCCCGGCCCCTCCCCTCCTGCCCCTCCCACTCTCTCTCCTTTCCACCCGAGATTCTAGTCAAGTGTA

GCTCTGAAGGCGTCCATGCAACTGTAGAAACTACTAGAGGATGCAGTGGTTTCTCCAGGAAAGACTGTAAGGTGGAGGAACCCTGGCCTTCCCAGCCTAT

TTTTGTAAATAAAATGTTATAAACTTGAAAT
Translation
MAGSLPPCVVDCGTG - UNI37645 - GYTKLGYAGNTEPQFIIPSC CIAIRESAKVVDQAQRRVLRGVDDLDFFIGDEAIDKPTYATK WPIRHGI

VEDWDLMERFMEQVVFKYLRAEPEDHYFLM TEPPLNTPENREYLAEIMFESFNVPGLYIAVQ AVLALAASWTSRQVGERTLTGIVIDSGDGVTHVIPV

 AEGYVIGSCIKHIPIAGRDITYFIQQLLREREVGIPPEQSLETAKAIK EKYCYICPDIVREFAKYDVDPRKWIKQYTGINAINQKKFIIDVGYERFLG

PEIFFHPE FANPDFMESISDVVDEVIQSCPIDVRRPLYK NVVLSGGSTMFRDFGRRLQRDLKRVVDARLKLSQELSGGRIK PKPVEVQVVTHHMQRY

AVWFGGSMLAST PEFFQVCHTKKDYEEYGPSICRHNPVFGVMS
Transcript ENSMUST00000070431
Sequence
CGGCGCTGCCTGCGACCCGGCACCTTGGCACTGGGCACCCAGGGGCACGCTGGGGCTGGTGGGGACGGAGCGCCTCGTGGCCGAGCATGGCGGGCTCGCT

GCCTCCCTGCGTGGTTGACTGCGGCACCGG - UNI37645 - GTATCGCCATCCGAGAATCTGCAAAGGTAGTTGATCAAGCCCAAAGGAGGGTGTTG

AGAGGAGTCGATGACCTTGATTTCTTCATAGGGGATGAAGCCATTGATAAACCTACCTACGCTACCAAG TGGCCTATACGACATGGCATCGTTGAAGAC

TGGGATCTTATGGAAAGGTTCATGGAACAAGTGGTCTTTAAGTATCTTCGTGCTGAACCTGAGGACCACTACTTTTTAATG ACAGAACCTCCACTGAAC

ACACCAGAAAACAGAGAGTACCTTGCAGAAATCATGTTTGAATCATTTAATGTACCAGGACTCTACATTGCAGTACAG GCAGTGCTGGCTCTGGCAGCC

TCTTGGACATCCCGGCAAGTTGGTGAACGCACACTAACGGGGATAGTTATAGACAGTGGAGACGGTGTCACCCATGTTATCCCGGTG GCAGAAGGTTAT

GTAATTGGAAGCTGCATCAAACACATCCCAATTGCAGGTAGAGATATTACGTATTTCATTCAACAGCTGCTAAGGGAGAGGGAGGTGGGAATCCCTCCTG

AGCAGTCACTGGAAACCGCAAAAGCCATCAAG GAGAAGTACTGCTACATTTGCCCGGATATTGTCAGAGAATTTGCTAAGTATGACGTAGATCCTCGGA

AGTGGATCAAACAGTACACAGGGATCAATGCCATCAACCAGAAGAAGTTCATTATAGATGTTGGTTATGAAAGGTTCCTGGGACCAGAAATATTCTTTCA

CCCTGAG TTTGCCAACCCAGACTTTATGGAGTCCATCTCGGATGTTGTCGATGAAGTCATACAGAGCTGTCCCATAGATGTGCGCCGGCCGCTGTATAA

G AACGTCGTTCTTTCTGGAGGCTCCACAATGTTCAGAGATTTTGGACGTCGTCTGCAGAGAGATTTGAAAAGAGTGGTGGACGCCAGGTTAAAGCTGAG

CCAAGAGCTCAGTGGAGGCAGGATAAAG CCTAAACCTGTGGAGGTGCAGGTGGTCACGCACCACATGCAGCGCTATGCCGTGTGGTTTGGAGGCTCGAT

GCTAGCCTCAACT CCGGAGTTCTTTCAGGTCTGTCACACCAAGAAGGACTATGAGGAATACGGCCCAAGCATCTGCCGCCACAACCCTGTCTTCGGAGT

CATGTCCTAGTGTCTGCGTTGGAGCCATTGTCTGACAAGTGTCCTGTTGGGGAATAAGTGTCCTTCAGAACCCAGAGCAGCCACGGCTCCTGTACATAGC

AGTGTGGAATGGGTGTGTGAGCAGCGTGCTTTCATCGCCAGTGGGGCCAGGCACGGTCTTCCCAGTAAAGCCATTTATCCGGTACGACTGTTCGTGGTCC

TCCTCCCGGCCCCTCCCCTCCTGCCCCTCCCACTCTCTCTCCTTTCCACCCGAGATTCTAGTCAAGTGTAGCTCTGAAGGCGTCCATGCAACTGTAGAAA

CTACTAGAGGATGCAGTGGTTTCTCCAGGAAAGACTGTAAGGTGGAGGAACCCTGGCCTTCCCAGCCTATTTTTGTAAATAAAATGTTATAAACTTGAAA

T
Translation
RRCLRPGTLALGTQGHAGAGGDGAPRGRAWRARCLPAWLTAAPG - UNI37645 - GIAIRESAKVVDQAQRRVLRGVDDLDFFIGDEAIDKPTYATK

 WPIRHGIVEDWDLMERFMEQVVFKYLRAEPEDHYFLM TEPPLNTPENREYLAEIMFESFNVPGLYIAVQ AVLALAASWTSRQVGERTLTGIVIDSGD

GVTHVIPV AEGYVIGSCIKHIPIAGRDITYFIQQLLREREVGIPPEQSLETAKAIK EKYCYICPDIVREFAKYDVDPRKWIKQYTGINAINQKKFIID

VGYERFLGPEIFFHPE FANPDFMESISDVVDEVIQSCPIDVRRPLYK NVVLSGGSTMFRDFGRRLQRDLKRVVDARLKLSQELSGGRIK PKPVEVQV

VTHHMQRYAVWFGGSMLAST PEFFQVCHTKKDYEEYGPSICRHNPVFGVMS

For any suggestions or comments, please send an email to unitrap@crg.es