Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000056592 (BC043301)
Chromosomal location
Chr 7: 50817626 - 50830831 (+)
Description
Putative uncharacterized protein  [Source:UniProtKB/TrEMBL;Acc:Q3U2V8]
RefSeq_dna
NM_001008549 
RefSeq_peptide
NP_001008549.1 
UniGene
Mm.333821 
MGI
MGI:2652821 
Uniprot/SPTREMBL
Q3U2V8 Q5PPQ4 Q80UY3 
Human Ortholog
not available
Omim not available
UniTrap UNI26248
Vector Insertion
Chr 7: 50820214 - 50822637
Public Clones not available
Private Clones OST128558 (lexicon)
Severity of mutation (?) Insertion after 2% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000107972
Sequence
GTGGTCTCGAGCGGTCATATCCGCTTAAATCTCCGCGCAGATCAGTTCTGTTATTGTTGCCCGCACTCCAGGAGAGTTTGGATTCTAACACTGAGGGCCC

GGGGGCGGAAGTCGCAGGGAGGGACACTGCGCGTCCTGTGCAGAGTTCTCTGCATTGTTGTGAGAG GTCAAAGGCAGGCCACATCAGCCAGGCTGGGGG

ATTTTTCTACCTCACCACAGCTGGCCTCTCTGCTCAGCTGCTCTCCTGGGAACCTCTAGCCACTCAACCAGCTTCCAGTTCCTGAGAAAAATTGCATCTG

CCAGCAAAGAGGCAAGAGAGGAAACATACCTGCTGACATGAAATTGTCCCAGAAGGCCCAGAGACTGCACCCACAGGAGCAGGAAGGGTCCCGTGAG - 

UNI26248 - AGATTGGTGTCCTTTGAGGATGTGACTGTGGACTTCAGCCAGGAGGAGTGGCGACGCCTGGACTCCGTCCAGAGACACCTGTACCAGGA

CGTGATGCTGGAGATCTACAGCCACCTCTTGGCAGTGG GCTACCCTGTTCCTAGCCCTGGGGCCATCTTCAGGATAAAGAAAAGAAAGGAGGCACGGAC

AGGAGAGGCCAAGCTCCCACATCCTTGTTGGTGTCAAG AAGTGGAATCAGAGTTTTACAGGCCTCAGCAGAAAGCATCTGAGGAGGCAGCATTCCAAAC

TAGTAAGGCAAGCGCAGTCACAAGGCATGGCTTGTGGTGCTCGATTTTAGAAGAACTGTGGCAAGATCCTGACCCTGCACAAAGAGATGGGCAAAACCAG

ATCCCACCCTGGAGTCCTGGGGCTTCCCTCAACAAGAAAACAGCGCGAGCAGATAGAGACTGTGGGTGGAAAGAGCCCGGGAAGACCACTCCCTTCGTAG

CTAACCTTTTTTCTACACAAAAGGGAGCTCCAAGGTTACTTGCAAAACGTTTGAACCCTAACCTTGAAGCCAACGGTGAAGAGCAAGGCAGTGTCACAAA

ACAGCTGAATGGTCTTGTTACATCTGCTCACCTCCTCCCGCAAGACTCTTCTAATGCTAACTGTACAATTCTTCGTGAAACATGGAATCCGTGCAAAGGT

AACCAGTGCAGAAAAGTTCCCACCCATAAACAACTGACAGAGAAAGAAGCTCATTCTCGTGAGAAACTAGATGAAGGCACGGAATGTAGAAAAGTCTTCT

ATGACGAATCTGCTTTCTGTAAACACCAGGCAGCTCACGCTGGAGAAGGACCTTTTGTCTGTCACAAGTGTGGGGAAGCCTTCCTCCAGAAGACAGAGTT

TGCCTCCCATCAAGAAACTCACCCAGAGAAACCTTATGAGTGTCCCGACTGCGGGAAGTCATTTAGTCGAACGTCCAACCTGCAGGTCCACCATCGAATT

CACACTGGAGAGAAACCTTATGAGTGTCGGGACTGTGGCAAATCATTCAATAATACATCCCAGCTGAAGGTACATTATCGGATACATACAGGGGAGAGAC

CTTACGTGTGTCCCGTATGTGGGAAGGCCTTCAAGCAGAAATCAATCCTCAGCACGCATGAGACAATTCACACTGGGGAGAAGCCTTACAAATGTACCGT

TTGTGGGAAACTGTTCAGCTGTACGTCCCGACTGAAAGTGCACTACCAGATTCATATGAAGGAGAAACCTTATGAATGCGGTGACTGTGGAAAAGCCTTC

AAGCGAAAGTCAAGCCTCACCGTTCACCAGAAGATCCATATCAGACAAACACACCACGAGTGCAGCGAGTGTGGGAAAACGTTCAACCAGAAGTCCGAGC

TCAGCACTCACCAGAGACTTCACCTGGGCAAGAATTCCCACAGATGCAGCGACTGTGGGAAATCGTTCACTTACGCATCCCAACTGAAGATGCACCGTCG

GGTTCACACGGGGGAGAAGCCCTACAAGTGCCGGGACTGTGGGAAGTCCTTTACGTACTCATTCACGCTGAATGTGCATCGCCGAATTCACAAGGTGGAG

AAGCCTCACAAGTGCAGCATCTGTGGGAAAGCTTTGGCGTCTAAGTACCAACTGGAAGAGCATGAGCGAATTCACACAGGAGAGAAGCCTTACGTGTGTA

CTGAATGTGGAAAAGGCTTCCATGGTAGGTCAGGTTTCCTAAGACATCAGATTACTCACACGAGGGATAAACCTTTCGTCTGTCATAAATGTGGGAAGGC

CTTCTTTCAGAGGTCACAGCTGACATCTCATCAGCAGACTCACACAGGAGAGAAGCCTTATACGTGCCATTACTGCGGGAAATCATTCAGTCACACATCC

CAGCTGACGGTCCATCATCGAATTCACACAGGGGAGAGACCTTACAAATGCGACTATTGTGCGAAGTCGTTCAGCAACTCCTCCCAACTGAAAGAGCATC

TCCGCATTCATACCGGGGAGACGCCTTATGCATGTTCCGAATGTGGGAAGGCCTTCAGCCGACGATCGTCCCTCAATCTACACACGAAAATTCATACTGG

AGAAAAACACCATATATGTAGTGAGTGTGGGAAAGCCTTTAGTCAGAAGTCAGTACTGCGGACACATCAGAGAATACACACTGGGGAAAAGCCTTACAAA

TGCAGTGACTGTGGGAAGGCCCTGGCTTCAAAGGGCCAACTTCGAGATCATCAGCGGATTCACACTGGCGAGAAACCCTACATGTGCCCTGAATGTGGGA

AGGGTTTCTTTGGCAGGTCGTCTTTGCATAGACATCAGATAACTCACACTAAGGAGAGACCTTTTGTCTGTCAAAAATGCGGGAAGACCTTCATCCAGAA

GTCAGCACTGACGTCCCATCAGCAAATTCACACAGGCGAGAAGCCCTATGTGTGCCCTGAGTGTGGGAAGGGCTTCTACAATAAGTCATCTTTACCTAGG

CATCAGATGACTCACACTAGGGGGAGATCTTTTGTCTGTCAAAAATGTGGGAAGGCATTCCTCCAGAAGTCTGTGTTGAAATGCCATCAGCGGACTCACA

CTTGCAAGAAGCCTTAGCAATGCCATAGGAAATTGTTCCATAATAAAACCCACTGAGGGGCCCTCATCATCCCTACATAGAAATGCAGAGAGCATCCCAA

CTGGATGTGCAGCACTGGGTCTAGAATGGAGAGAGACACTACTGTGTTCTGAGTGTTAAAAGGCTTTTAACAGCATGTCAGATGATAATAAATAGCAAGC

AGCTCATAGTAGACACAGTTCTTTTTAGGCTCAGTTTTTGTGTGAAGCATATTTCCTCATAGTCTATAAACATATTCCTAACTGAGGTATAATCTTTAAA

TTACTTGAAGAGAATGTTTTAAAAGAATTTATTGGGGCTGGAGAGATGGCTTAAGAGCGCTGGCTGCTCTCCCAGAGGTCCTGAGTTCAATTCCCAACAA

CTACATGGTGGCTCACAACCGTCTATAATGAGATCCGATGCCCTCTTCTGGTGTGTCTGAAAGCAGCGACAGTGTACTCACATACATGAAATAAATCTTT

TTTTTTAAAGGA
Translation
 MKLSQKAQRLHPQEQEGSRE - UNI26248 - RLVSFEDVTVDFSQEEWRRLDSVQRHLYQDVMLEIYSHLLAVG GYPVPSPGAIFRIKKRKEART

GEAKLPHPCWCQE EVESEFYRPQQKASEEAAFQTSKASAVTRHGLWCSILEELWQDPDPAQRDGQNQIPPWSPGASLNKKTARADRDCGWKEPGKTTPF

VANLFSTQKGAPRLLAKRLNPNLEANGEEQGSVTKQLNGLVTSAHLLPQDSSNANCTILRETWNPCKGNQCRKVPTHKQLTEKEAHSREKLDEGTECRKV

FYDESAFCKHQAAHAGEGPFVCHKCGEAFLQKTEFASHQETHPEKPYECPDCGKSFSRTSNLQVHHRIHTGEKPYECRDCGKSFNNTSQLKVHYRIHTGE

RPYVCPVCGKAFKQKSILSTHETIHTGEKPYKCTVCGKLFSCTSRLKVHYQIHMKEKPYECGDCGKAFKRKSSLTVHQKIHIRQTHHECSECGKTFNQKS

ELSTHQRLHLGKNSHRCSDCGKSFTYASQLKMHRRVHTGEKPYKCRDCGKSFTYSFTLNVHRRIHKVEKPHKCSICGKALASKYQLEEHERIHTGEKPYV

CTECGKGFHGRSGFLRHQITHTRDKPFVCHKCGKAFFQRSQLTSHQQTHTGEKPYTCHYCGKSFSHTSQLTVHHRIHTGERPYKCDYCAKSFSNSSQLKE

HLRIHTGETPYACSECGKAFSRRSSLNLHTKIHTGEKHHICSECGKAFSQKSVLRTHQRIHTGEKPYKCSDCGKALASKGQLRDHQRIHTGEKPYMCPEC

GKGFFGRSSLHRHQITHTKERPFVCQKCGKTFIQKSALTSHQQIHTGEKPYVCPECGKGFYNKSSLPRHQMTHTRGRSFVCQKCGKAFLQKSVLKCHQRT

HTCKKP
Transcript ENSMUST00000005597
Sequence
GCTGGGGGATTTTTCTACCTCACCACAGCTGGCCTCTCTGCTCAGCTGCTCTCCTGGGAACCTCTAGCCACTCAACCAGCTTCCAGTTCCTGAGAAAAAT

TGCATCTGCCAGCAAAGAGGCAAGAGAGGAAACATACCTGCTGACATGAAATTGTCCCAGAAGGCCCAGAGACTGCACCCACAGGAGCAGGAAGGGTCCC

GTGAG - UNI26248 - AGATTGGTGTCCTTTGAGGATGTGACTGTGGACTTCAGCCAGGAGGAGTGGCGACGCCTGGACTCCGTCCAGAGACACCTG

TACCAGGACGTGATGCTGGAGATCTACAGCCACCTCTTGGCAGTGG GCTACCCTGTTCCTAGCCCTGGGGCCATCTTCAGGATAAAGAAAAGAAAGGAG

GCACGGACAGGAGAGGCCAAGCTCCCACATCCTTGTTGGTGTCAAG AAGTGGAATCAGAGTTTTACAGGCCTCAGCAGAAAGCATCTGAGGAGGCAGCA

TTCCAAACTAGTAAGGCAAGCGCAGTCACAAGGCATGGCTTGTGGTGCTCGATTTTAGAAGAACTGTGGCAAGATCCTGACCCTGCACAAAGAGATGGGC

AAAACCAGATCCCACCCTGGAGTCCTGGGGCTTCCCTCAACAAGAAAACAGCGCGAGCAGATAGAGACTGTGGGTGGAAAGAGCCCGGGAAGACCACTCC

CTTCGTAGCTAACCTTTTTTCTACACAAAAGGGAGCTCCAAGGTTACTTGCAAAACGTTTGAACCCTAACCTTGAAGCCAACGGTGAAGAGCAAGGCAGT

GTCACAAAACAGCTGAATGGTCTTGTTACATCTGCTCACCTCCTCCCGCAAGACTCTTCTAATGCTAACTGTACAATTCTTCGTGAAACATGGAATCCGT

GCAAAGGTAACCAGTGCAGAAAAGTTCCCACCCATAAACAACTGACAGAGAAAGAAGCTCATTCTCGTGAGAAACTAGATGAAGGCACGGAATGTAGAAA

AGTCTTCTATGACGAATCTGCTTTCTGTAAACACCAGGCAGCTCACGCTGGAGAAGGACCTTTTGTCTGTCACAAGTGTGGGGAAGCCTTCCTCCAGAAG

ACAGAGTTTGCCTCCCATCAAGAAACTCACCCAGAGAAACCTTATGAGTGTCCCGACTGCGGGAAGTCATTTAGTCGAACGTCCAACCTGCAGGTCCACC

ATCGAATTCACACTGGAGAGAAACCTTATGAGTGTCGGGACTGTGGCAAATCATTCAATAATACATCCCAGCTGAAGGTACATTATCGGATACATACAGG

GGAGAGACCTTACGTGTGTCCCGTATGTGGGAAGGCCTTCAAGCAGAAATCAATCCTCAGCACGCATGAGACAATTCACACTGGGGAGAAGCCTTACAAA

TGTACCGTTTGTGGGAAACTGTTCAGCTGTACGTCCCGACTGAAAGTGCACTACCAGATTCATATGAAGGAGAAACCTTATGAATGCGGTGACTGTGGAA

AAGCCTTCAAGCGAAAGTCAAGCCTCACCGTTCACCAGAAGATCCATATCAGACAAACACACCACGAGTGCAGCGAGTGTGGGAAAACGTTCAACCAGAA

GTCCGAGCTCAGCACTCACCAGAGACTTCACCTGGGCAAGAATTCCCACAGATGCAGCGACTGTGGGAAATCGTTCACTTACGCATCCCAACTGAAGATG

CACCGTCGGGTTCACACGGGGGAGAAGCCCTACAAGTGCCGGGACTGTGGGAAGTCCTTTACGTACTCATTCACGCTGAATGTGCATCGCCGAATTCACA

AGGTGGAGAAGCCTCACAAGTGCAGCATCTGTGGGAAAGCTTTGGCGTCTAAGTACCAACTGGAAGAGCATGAGCGAATTCACACAGGAGAGAAGCCTTA

CGTGTGTACTGAATGTGGAAAAGGCTTCCATGGTAGGTCAGGTTTCCTAAGACATCAGATTACTCACACGAGGGATAAACCTTTCGTCTGTCATAAATGT

GGGAAGGCCTTCTTTCAGAGGTCACAGCTGACATCTCATCAGCAGACTCACACAGGAGAGAAGCCTTATACGTGCCATTACTGCGGGAAATCATTCAGTC

ACACATCCCAGCTGACGGTCCATCATCGAATTCACACAGGGGAGAGACCTTACAAATGCGACTATTGTGCGAAGTCGTTCAGCAACTCCTCCCAACTGAA

AGAGCATCTCCGCATTCATACCGGGGAGACGCCTTATGCATGTTCCGAATGTGGGAAGGCCTTCAGCCGACGATCGTCCCTCAATCTACACACGAAAATT

CATACTGGAGAAAAACACCATATATGTAGTGAGTGTGGGAAAGCCTTTAGTCAGAAGTCAGTACTGCGGACACATCAGAGAATACACACTGGGGAAAAGC

CTTACAAATGCAGTGACTGTGGGAAGGCCCTGGCTTCAAAGGGCCAACTTCGAGATCATCAGCGGATTCACACTGGCGAGAAACCCTACATGTGCCCTGA

ATGTGGGAAGGGTTTCTTTGGCAGGTCGTCTTTGCATAGACATCAGATAACTCACACTAAGGAGAGACCTTTTGTCTGTCAAAAATGCGGGAAGACCTTC

ATCCAGAAGTCAGCACTGACGTCCCATCAGCAAATTCACACAGGCGAGAAGCCCTATGTGTGCCCTGAGTGTGGGAAGGGCTTCTACAATAAGTCATCTT

TACCTAGGCATCAGATGACTCACACTAGGGGGAGATCTTTTGTCTGTCAAAAATGTGGGAAGGCATTCCTCCAGAAGTCTGTGTTGAAATGCCATCAGCG

GACTCACACTTGCAAGAAGCCTTAGCAATGCCATAGGAAATTGTTCCATAATAAAACCCACTGAGGGGCCCTCATCATCCCTACATAGAAATGCAGAGAG

CATCCCAACTGGATGTGCAGCACTGGGTCTAGAATGGAGAGAGACACTACTGTGTTCTGAGTGTTAAAAGGCTTTTAACAGCATGTCAGATGATAATAAA

TAGCAAGCAGCTCATAGTAGACACAGTTCTTTTTAGGCTCAGTTTTTGTGTGAAGCATATTTCCTCATAGTCTATAAACATATTCCTAACTGAGGTATAA

TCTTTAAATTACTTGAAGAGAATGTTTTAAAAGAATTTATTGGGGCTGGAGAGATGGCTTAAGAGCGCTGGCTGCTCTCCCAGAGGTCCTGAGTTCAATT

CCCAACAACTACATGGTGGCTCACAACCGTCTATAATGAGATCCGATGCCCTCTTCTGGTGTGTCTGAAAGCAGCGACAGTGTACTCACATACATGAAAT

AAATCTTTTTTTTTAAAGG
Translation
MKLSQKAQRLHPQEQEGSRE - UNI26248 - RLVSFEDVTVDFSQEEWRRLDSVQRHLYQDVMLEIYSHLLAVG GYPVPSPGAIFRIKKRKEARTG

EAKLPHPCWCQE EVESEFYRPQQKASEEAAFQTSKASAVTRHGLWCSILEELWQDPDPAQRDGQNQIPPWSPGASLNKKTARADRDCGWKEPGKTTPFV

ANLFSTQKGAPRLLAKRLNPNLEANGEEQGSVTKQLNGLVTSAHLLPQDSSNANCTILRETWNPCKGNQCRKVPTHKQLTEKEAHSREKLDEGTECRKVF

YDESAFCKHQAAHAGEGPFVCHKCGEAFLQKTEFASHQETHPEKPYECPDCGKSFSRTSNLQVHHRIHTGEKPYECRDCGKSFNNTSQLKVHYRIHTGER

PYVCPVCGKAFKQKSILSTHETIHTGEKPYKCTVCGKLFSCTSRLKVHYQIHMKEKPYECGDCGKAFKRKSSLTVHQKIHIRQTHHECSECGKTFNQKSE

LSTHQRLHLGKNSHRCSDCGKSFTYASQLKMHRRVHTGEKPYKCRDCGKSFTYSFTLNVHRRIHKVEKPHKCSICGKALASKYQLEEHERIHTGEKPYVC

TECGKGFHGRSGFLRHQITHTRDKPFVCHKCGKAFFQRSQLTSHQQTHTGEKPYTCHYCGKSFSHTSQLTVHHRIHTGERPYKCDYCAKSFSNSSQLKEH

LRIHTGETPYACSECGKAFSRRSSLNLHTKIHTGEKHHICSECGKAFSQKSVLRTHQRIHTGEKPYKCSDCGKALASKGQLRDHQRIHTGEKPYMCPECG

KGFFGRSSLHRHQITHTKERPFVCQKCGKTFIQKSALTSHQQIHTGEKPYVCPECGKGFYNKSSLPRHQMTHTRGRSFVCQKCGKAFLQKSVLKCHQRTH

TCKKP

For any suggestions or comments, please send an email to unitrap@crg.es