Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000056673 (Jarid1d)
Chromosomal location
Chr Y: 234231 - 280254 (+)
Description
jumonji, AT rich interactive domain 1D (Rbp2 like) Gene [Source:MGI Symbol;Acc:MGI:99780]
Human Ortholog
not available
Omim not available
UniTrap UNI36803
Vector Insertion
Chr Y: 237057 - 246890
Public Clones IST14648G4 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 14% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000055032
Sequence
ACATTGTGATCTAAAAATGGTGGAACCGAACGAGGAGGTGAATATTTGTAAGAATGTGGAATTAAGCAAACTCTGAAATTTAGAAGAAAATAAAGTTCCT

GGGTGCCACGCAGTGAGTAGGCAATTCCATTCGCCCTTTAATATCGAATCACTTTTTATAACCGCGTTTTGAGCGAACATGAAGCCAGGATCTGACGACT

TTCTACCGCCGCCTGAGTGCCCTGTGTTTGAGCCCAGTTGGGCGGAATTCCGCGATCCTCTTGGCTATATAGCTAAAATCAGACCCATTGCGGAGAAATC

AGGCATTTGCAAGATACGCCCACCTGCG GATTGGCAACCTCCTTTTGCTGTAGAAGTTGATAACTTCAGATTTACTCCTCGAATTCAGAGGCTAAATGA

ACTGGAG GCCCAGACCAGAGTAAAACTGAACTATTTGGATCAGATTGCAAAGTTCTGGGAAATTCAAGGTTCTTCCTTAAAGATACCTAATGTGGAGAG

GAAGATCTTGGACCTTTACAGCCTTAATAAG ATTGTGATGGAGGAAGGTGGATATGAAGCAATCTGCAAGGACCGTCGGTGGGCCCGTGTTGCCCAACG

CCTTAATTACCCATCAGGGAAAAACATTGGTTCCCTGCTTCGGTCCCACTACGAACGGATCATTTACCCTTATGAAATATTTCAGTCTGGAGCTAATCTT

GTG CAATGTAACACAGATCCATTTGACAGTGAAGAAAGAGACAAGGAATACAAACCTCATAGCATTCCTCTTAGACAGTCTGTTCAGCCATCAAAATTC

AGTTGCTACAGTAGACGAGGAAAAAGGCTACAGCCTGAG - UNI36803 - CCAGAACCCACAGAAGAAGACATTGAGAAAAACCCAGAGCTAAAGAA

ACTACAGATATATGGGGCAGGCCCCAAGATGATAGGCTTGGGCCTCAAGGCTAAGGAGAAAACTCTGAGAAAGAAAGATAGCAAACAACCAG ATAAAGA

AGAAGTGACATGCCCTGCAACTATTGTAGTGAAGGGGGAAGCCAGTGAGTTTGGAAAGGTGACATCAGCATTTTCAGACAAGAACTTAAATCACAGTTTT

GAACCTTGTATGAAGATGACTATGCAGCTACGGAACAATCACAGCAGTACCCAGTTT ATGAATTCATATGTTTGCCGAATATGCTCTCGTGGGGATGAA

GTCGATAAGTTTCTGCTCTGTGATGGCTGCAGTGATAATTACCACATCTTTTGCCTATTGCCACCGCTTTCTGAAGTCCCCAAGGGAGTATGGAGATGCC

CGAAGTGTATCTTAGCA GAGTGTAAGAGTCCCCCTGAAGCTTTTGGCTTTGAGCAGGCTACACAGGAGTATACTTTGCAGAGTTTTGGTGAGATGGCTG

ACTCCTTCAAGGCTGACTACTTCAACATGCCTGTGCAT ATGGTACCTACAGAAGTTGTGGAAAAGGAATTCTGGAGGCTGGTGAGCAGCATTGAGGAGG

ATGTGACAGTTGAATATGGAGCAGACATTCACTCCAAAGAATTTGGCAGTGGGTTTCCTGTCAACAATAGCAAATGGGACTTATCTCCTGAAGAAAAG G

AATATGCTGCTTGTGGTTGGAATCTCAATGTGATGCCAGTGCTGGATCAGTCTGTTCTCTGCCACATCAATGCAGACATCTCAGGCATGAAAGTGCCCTG

GTTATATGTGGGCATGGTGTTTTCAGCATTTTGTTGGCATATTGAGGATCACTGGAGTTATTCCATTAACTACCTGCACTG GGGTGAACCAAAGACCTG

GTATGGAGTACCTTCGCTAGCAGCAGAACACTTAGAGGATGTAATGAAGAGACTTACACCAGAGTTGTTTGACAGCCAACCTGACCTCCTGCACCAACTT

GTCACTCTGATGAATCCTAACACTCTCATGTCACATGGAGTGCCA GTTGTTCGTACAAACCAGTGTGCAGGGGAATTTGTCATTACTTTTCCCCGTGCT

TACCACAGTGGCTTTAACCAAGGCTATAACTTTGCTGAGGCAGTGAACTTTTGCACTGCCGATTGG CTACCTGTTGGACGCCAGTGTATTGAACACTAC

CGCCGACTCCGGCGCTATTGTGTCTTCTCCCATGAAGAACTTATCTGCAAGATGGCTGCATTTCCAGAGAAGTTGGATCTAAATCTAGCAGTGGCAGTTC

ACAAGGAGATGTTCATTATGGTACAGGAGGAGCGACGCCTACGAAAGACCTTGTTGGAGAAG GGCATCACGGAAGCTGAGCGAGAGGCTTTTGAGCTAC

TCCCAGATGATGAGCGTCAGTGCATCAAGTGTAAGACCACGTGTTTCCTATCAGCCTTGGCCTGTTATGACTGTCCAGATAGTCTTGTCTGCCTTTCCCA

TATCAATGATCTGTGCAAGTGCTCAAGGAATCGACAGTACTTACG GTACAGGTACACATTGGATGAACTGCCTGCTATGCTACAAAAGCTGAAGATTCG

AGCTGAGTCATTTGACAACTGGGCCAACAAAGTACAAGCAGCCCTAGAGGTGGAGGATGGTCGGAAACGGA GTTTTGAAGAGCTAAGAGCATTGGAATC

TGAGGCTCGTGATAGACGATTTCCTAATAGTGAGCTGCTTCAGCGATTGAAGAAATGCCTAACTGAAGCAGAGGCTTGTATTTCCCAAGTTCTTGGACTG

ATCAGTAACTCAGAGGACAG GTTACAAACACCGCAAATCACCCTTACTGAACTACAGCTTCTTCTCAAACAGATGGGCACTCTGCCCTGTACCATGCAT

CAGATTGATGAAGTTAAG GATGTTCTTCAACAGGTGGAATCATACCAAATTGAGACCCGTGAGGCTCTAACTTCACTGCCTTACAGTTTAGAAATACTT

CAGTCCCTGATGGAAAAGGGTCAGCAGCTTCGTGTGGAAGTGCCTGAAGCTCATCAACTTGAAGAGCTGTTGGAGCAGGCACAATGGCTAGATCAAGTGA

AGCAGGCCCTGGCTCCCTCAGGCCAGAGGCACTCTTTGGTTATCATGAAGAAGCTTTTAGTTATGGGAACCAAGGTAGCCTCCAGCCCTTCTGTGAACAA

AGCTCGAGCAGAGTTACAAGAACTGCTGACTATTGCAGAATGTTGGGAGGAAAAGGCCCATTTTTGCTTAAAAGCTAG CCAAAAGCATTCTCCAGCCAC

TTTGGAAGTTATAATACGTGAGGCAGAAAACATCCCTGTCTACCTACCTAACATCCAGTCTCTGAAGGAAGCTCTGACTAAGGCACAGGCTTGGATTGCT

GATGTGAATGAGATTCAA AATGGTGATCACTACCCCTGTTTGGATGATTTGGAGGGCCTTGTAGCTGTTGGTCGGGATTTACCTGTGGAGCTAGAGGAA

TTGAGACAGCTGGAGAATCAGGTACTAACAGCACATTCCTGGAAAGAGAAAGCTTCTAAGACTTTTCTTAAGAAGAATTCTTGCTACACATTGTTGGAG 

GTTCTCTGCCCATGTGCAGATGCTGGTTCAGTCAGCACCAAGCGCAGTCGGTGGATTGAAAAGGAGATGGGATTATACAAATATGACACAGAATTGCTGG

GGCTGTCTGCACAGGACCTCAGGGACCCAGGGTCTGTG ATCATGGCCTTTAAGGAAGGGGAAGAGAAAGAAAAGGAAGGTATCTTGCACTTACGTCACA

TCAACTCAGCCAAGCCCAGTCCAATGTCCTCATCGATGAATGCCTCTGCAACCTCCATCTGTATATGTGGGCAGGTCTGTGCAGGAGTGGAATCTCTGCA

GTGTGATCTTTGTCATGACTGGTTCCATGGACAATGTGTGACTGTACCCCACCTACTCAGCTCAGTAAGGGCCAGTCATACCTCATCTCAACTGCTAGCT

TGGTGGGAATGGGACACCAAGTTCCTGTGCCCACTGTGCATGCGATCAAGGCGTCCACGCCTGGAGACCATCTTGTCATTGCTGGTAGGACTACAGAGAC

TGTCTGTAAGGCTACCTGAGGGTGAGGCCCTACAGTGCCTCACAGAGAGAGCCATTGGTTGGCAAGGCCGTGCCAGGCAGGCTCTAGCTTCTGAGGATGT

GACTGCTTTGTTGAAACAGCTGGAAAAATCCCGCCAACAACTACAGGATGAATTGAGACATAAGAAGCCCCCTACCTTGCCTTCAGGCTTTGCCTTTGAC

TGTCTCACAGAGAATAGTGGCAAGGATATCCTTAAG GAAGAGGAGGAGTTGGTACTAAATGAAGAAAGGATTAAAAGTTCTGAGAAGATTGTTCCAAAG

GAAAGTTCATGTAAAGGAG ATAAGGAACTGCTGCCTTCACTTTTATCCCAATTAACTGGCCCAGTACTGGAACTGCCTGAAGCCACCCGGGCACCCCTA

GAGGAGCTTATGATGGAAGGAGATCTACTTGAAGTTACCCTAGATGAGAACTACAGCATTTGGCAGCTGCTGCAGGCTGGGCAGAATCCCAATCTAGAGC

GCATTCATACACTTCTGGAG CTTGAGAAGCCTGAAAACCCAGGAAATTGGTCAGAGGAACAGACACCAGAGAGGCGACGGCAGAGGAGGCAAAAGGTGG

TTCTGAGTAGAAAGGGTGAGGATTTTACTCAAAAAGAGCTAGAATCAAAAAGAGTCAAGAGTTCAAGGATTAAGCCTAAGGAAGAAAAGTTTCAAAAGCC

AATACTTGGGGATAATGTGCTGTACACACACCATACAGAACATACAAACATCTTAAAAGAGCACATAAACAGTGTACAAGGAAAGGATCCAAGCCCTTCA

TCTTCTTTTCCTTCCTTAACACCTTTACTACACCTATCTTATTTTCATCAGCAAAAATTATAACAATAGTATGTGATTATAACAATAGTATGTGATTGTT

CTTTTTTCCTACCTTAGTCTTTTCCATTCTCCCTCCCTTGTTCTTTCTTTCCTTCTTCTTTTTCATTTCTTTCTGTTGGTCCCTTCCTTTCCTCCATTTT

ACTCTATTCCTACAGCTTCCTCTGCCCTTAATCCCTCAGATACCCCCAAAGTATTTGTTTCTTATCTAGAGCTTGACCACAAATTATTTTATCCTTACTC

CTAATACATTTTTATGCCATAATTCCTAAGAAGTATTCCCTGTATGCGTTTCCCAAAATTTTACCATCAATATTCCTGGGACTAGCATAGATAAAGTGAT

GTTCTTAGTTATCTCTATTCTAATCTGGAGAGACAAAAATAAAATTTGAGAATGATAACATTTATTAATCTTTATTTTTAAATCCTTCATCAATCACACA

TCAAAACAAGTACTTATTAAAACAAGTGTCTTTTAGTTTATAATTTTCATTCTATTTTTCTCTTTGGTTTACATTCTAAAAGAACGTTGTATTTTTAATT

CTTAAGAAAAAGGAATATATACAGTAATGCAAACTTACCATAATTGTTTATTTTTAATTTTGTTCCTTTTGATTTTGTTGTTAAAAATAAAACAGTATGG

TTAGAACTG
Translation
MKPGSDDFLPPPECPVFEPSWAEFRDPLGYIAKIRPIAEKSGICKIRPPA DWQPPFAVEVDNFRFTPRIQRLNELE AQTRVKLNYLDQIAKFWEIQGS

SLKIPNVERKILDLYSLNK IVMEEGGYEAICKDRRWARVAQRLNYPSGKNIGSLLRSHYERIIYPYEIFQSGANLV QCNTDPFDSEERDKEYKPHSIP

LRQSVQPSKFSCYSRRGKRLQPE - UNI36803 - PEPTEEDIEKNPELKKLQIYGAGPKMIGLGLKAKEKTLRKKDSKQPD DKEEVTCPATIVVKG

EASEFGKVTSAFSDKNLNHSFEPCMKMTMQLRNNHSSTQF MNSYVCRICSRGDEVDKFLLCDGCSDNYHIFCLLPPLSEVPKGVWRCPKCILA ECKSP

PEAFGFEQATQEYTLQSFGEMADSFKADYFNMPVH MVPTEVVEKEFWRLVSSIEEDVTVEYGADIHSKEFGSGFPVNNSKWDLSPEEK EYAACGWNLN

VMPVLDQSVLCHINADISGMKVPWLYVGMVFSAFCWHIEDHWSYSINYLHW WGEPKTWYGVPSLAAEHLEDVMKRLTPELFDSQPDLLHQLVTLMNPNT

LMSHGVP VVRTNQCAGEFVITFPRAYHSGFNQGYNFAEAVNFCTADW LPVGRQCIEHYRRLRRYCVFSHEELICKMAAFPEKLDLNLAVAVHKEMFIM

VQEERRLRKTLLEK GITEAEREAFELLPDDERQCIKCKTTCFLSALACYDCPDSLVCLSHINDLCKCSRNRQYLR RYRYTLDELPAMLQKLKIRAESF

DNWANKVQAALEVEDGRKRS SFEELRALESEARDRRFPNSELLQRLKKCLTEAEACISQVLGLISNSEDR RLQTPQITLTELQLLLKQMGTLPCTMHQ

IDEVK DVLQQVESYQIETREALTSLPYSLEILQSLMEKGQQLRVEVPEAHQLEELLEQAQWLDQVKQALAPSGQRHSLVIMKKLLVMGTKVASSPSVNK

ARAELQELLTIAECWEEKAHFCLKAS SQKHSPATLEVIIREAENIPVYLPNIQSLKEALTKAQAWIADVNEIQ NGDHYPCLDDLEGLVAVGRDLPVEL

EELRQLENQVLTAHSWKEKASKTFLKKNSCYTLLE VLCPCADAGSVSTKRSRWIEKEMGLYKYDTELLGLSAQDLRDPGSV IMAFKEGEEKEKEGILH

LRHINSAKPSPMSSSMNASATSICICGQVCAGVESLQCDLCHDWFHGQCVTVPHLLSSVRASHTSSQLLAWWEWDTKFLCPLCMRSRRPRLETILSLLVG

LQRLSVRLPEGEALQCLTERAIGWQGRARQALASEDVTALLKQLEKSRQQLQDELRHKKPPTLPSGFAFDCLTENSGKDILK EEEELVLNEERIKSSEK

IVPKESSCKGD DKELLPSLLSQLTGPVLELPEATRAPLEELMMEGDLLEVTLDENYSIWQLLQAGQNPNLERIHTLLE LEKPENPGNWSEEQTPERRR

QRRQKVVLSRKGEDFTQKELESKRVKSSRIKPKEEKFQKPILGDNVLYTHHTEHTNILKEHINSVQGKDPSPSSSFPSLTPLLHLSYFHQQKL

For any suggestions or comments, please send an email to unitrap@crg.es