Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000056692 (D17Wsu92e)
Chromosomal location
Chr 17: 27888181 - 27957487 (-)
Description
Uncharacterized protein C6orf106 homolog  [Source:UniProtKB/Swiss-Prot;Acc:Q3TT38]
RefSeq_dna
NM_001044719 NM_001033279 
RefSeq_peptide
NP_001038184.1 NP_001028451.2 
UniGene
Mm.196577 
MGI
MGI:106281 
Uniprot/SWISSPROT
Q3TT38 
Uniprot/SPTREMBL
B2KF54 B2KF52 A2RT11 
Human Ortholog
ENSG00000196821 (C6orf106)
Omim not available
UniTrap UNI6452
Vector Insertion
Chr 17: 27957121 - 27957488
Public Clones CSA124 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI13150
Vector Insertion
Chr 17: 27931009 - 27957121
Public Clones (sanger) CMHD-GT_325H5-3 (cmhd) FHCRC-GT-S13-6D1 (fhcrc) IST14430F4 (tigm)
IST11536H4 (tigm) IST14874C10 (tigm) IST14894F5 (tigm) IST14102A2 (tigm)
IST14905B8 (tigm) IST14079H12 (tigm) IST14824G12 (tigm) IST13150B2 (tigm)
IST14843C11 (tigm) IST12496B6 (tigm) IST13612B3 (tigm) IST12838E8 (tigm)
IST14291A8 (tigm) IST15057F6 (tigm) IST14432F1 (tigm) IST11904A12 (tigm)
IST11129D10 (tigm) IST14822E10 (tigm) IST12111E5 (tigm) IST14615A5 (tigm)
IST14854A4 (tigm) IST15015H2 (tigm) IST11495B5 (tigm) IST11804E10 (tigm)
IST14897B9 (tigm)
Private Clones OST442309 (lexicon) OST433090 (lexicon) OST432964 (lexicon) OST432792 (lexicon)
OST427508 (lexicon) OST420540 (lexicon) OST401521 (lexicon) OST379733 (lexicon)
OST371323 (lexicon) OST320412 (lexicon) OST232188 (lexicon) OST198754 (lexicon)
OST198396 (lexicon) OST176498 (lexicon) OST148089 (lexicon) OST129851 (lexicon)
OST111579 (lexicon) OST101544 (lexicon) OST46454 (lexicon) OST40165 (lexicon)
OST37543 (lexicon) OST34383 (lexicon) OST34223 (lexicon)
Severity of mutation (?) Insertion after 24% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI6766
Vector Insertion
Chr 17: 27923214 - 27930853
Public Clones HMA348 (baygenomics)
Private Clones OST388339 (lexicon) OST243308 (lexicon) OST176499 (lexicon)
Severity of mutation (?) Insertion after 48% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI5299
Vector Insertion
Chr 17: 27905185 - 27923015
Public Clones YTB048 (baygenomics) (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 79% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI13302
Vector Insertion
Chr 17: 27905080 - 27905185
Public Clones CMHD-GT_340C2-3 (cmhd)
Private Clones OST427116 (lexicon)
Severity of mutation (?) Insertion after 79% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI21666
Vector Insertion
Chr 17: 27890941 - 27904433
Public Clones not available
Private Clones OST321949 (lexicon)
Severity of mutation (?) Insertion after 95% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000114859
Sequence
CCCATGAGGCGGTGAGAGGCCTGGGGCCTGTCTCGGAGCAGTGCGCGCGGCGCCGGCCAGCAGCGGGCCGCCCTTCGTGGGCTCGGGCCCGGGCGCGGCG

GCCGCCCGTGGAGAAGCAGGTCGGGGCGGTGGAAGCTGTGCGTCCGGGCCCCCCGCCATGGAGGGCATGGACGTGGACTTGGATCCGGAGCTCATGCAGA

AGTTCAGCTGCCTGGGCACCACAGACAAGGACGTGCTCATCTCCGAGTTCCAGCGGCTACTCGGCTTCCAGCTCAACCCGGCCGGCTGCGCCTTCTTCCT

GGACATGACCAACTG - UNI6452 - - UNI13150 - GAACTTACAAGCAGCGATTGGCGCCTATTATGACTTCGAGAGCCCAAATATCAGTGTGC

CCTCCATGTCCTTTGTTGAAGATGTCACCATAGGAGAAGGGGAGTCAATACCCCCTGATACCCAGTTCATAAAAACTTGGCGGATACAGAATTCTG - U

NI6766 - GAGCAGAGGCCTGGCCTCCAGGGGTTTGTCTTAAATATGTCGGGGGAGACCAGTTTGGACATGTGAACATGGTGATGGTGAGATCACTAGA

GCCCCAAGAGATCGCAGACGTCAGCGTCCAGATGTGCAGTCCCAGCAGAGCAGGCATGTACCAGGGACAGTGGCGGATGTGCACTGCTACTGGACTCTAC

TATGGAG - UNI5299 - - UNI13302 - ATGTCATCTGGGTGATTCTCAGTGTGGAGGTGGGTGGACTTTTAGGAGTAACGCAGCAGCTGTCATC

TTTTGAAACGGAATTCAACACACAGCCACATCGCAAG - UNI13302 - - UNI21666 - GGGCTCCACGGGCCTTACCCCTTCGGCCAGTCTTAA

ACGGGTGTCAGCAAGAAGAAAAACTAACAAAAGACAGAAGGCCTGACTTTGGGGGGAGAGGGCAAGGGGTTCCTCTGGATTGCAGACCACATCGCACGGA

CCCCTGGCTCAGACCCCCACCTACCCCCCAATCACAGAAGAAGAGGAAGAAAGAGACTAGTTTTGAGTGAACTCAGTATGCATGTGTGAATGCTGAACTG

CAGGAGTGGTGTTGAGGCGACCGAGAAGATCCACGCAGCCATCTTGGGTTTTGGTGATGACGTCAGTCTAATGAGTTGTTAGGTCACTTGGGAAGGGGAA

GAAATTTAAATGGGGGAAAATAAGCCATCTTTTTAAACAAAAATTATTTTACCTACAGAGAGGTTGTAGTTTTGAGCACATGTTAGTTCCTCCCTCTTCC

CGATGTTCATCTTCTAAGTAAGGGACAGCATGCTACAGGACAGACCTGCTCTGGAAGCCTGTCATAGTAAGGCTGGCGTGGCACGTTTGGGGACTCTGCC

AGTCGGAGTTGCTGGGCACATGCTGTGTACCACCGACTGCAGTCTGGCCCTGTTCTTAGTGGCATCTGCCAATGAGATATCACCTTCCCCCTCTCCTCTT

TAATCTCTTGTTAAATTACCCCTTTGATATTGGTGTCTGTCAGCGTTGGGGCTTCTTAGTATCAGGACCTCTCTGAGGTAAGGACTTTCCTGTGTGGCCA

CAGAAACCTGGGGGCATTCCGTTGCAGAGGTGTCCTCTGTCACGTGTGTAACAGCTGGAACACAGTGGCCGTCTTCCCTCGGCTCTTGTTGGTGTGTGCA

TGTGCTGCGTGCACACCGGGTTGTATGGCGTCAGCAGGTGTGAGCTGTCCCTTGCTTCTCTTGTCACACAGTGCCCCTTCCCCACGTGTCCTGTGGCTCC

AGCCATTACAGAGTGAAGGTGCAACCCCATGTGGGAGCCCCACTAGTGACCACTCCCTGAGAGGCCGCAATCAGGTGGGAATGAAAAGGCCTCCTCCAGC

GGGGCAGGCTGCTCAGTGTGGGTGGCAAGTTGTAGCCCAGCTGGAGGACAGGCCTTTGCTCCCTGGGCAGGTGCCCACTGGTGTCCCATGGAATCCACTC

GGGTTGAAATGTGGATCTCTCCATGGGACTCTTTAACCAGGCTAGAACAGCTGTCTGCCAAAGATACAAGAATATGCAAAGTCCCTCCTCCTAACCCTCC

TTCCCTCTAAGTCGGTGGCTTGAGAGCCGGGGATGTGGATTTGGTGTGGTTACAGGGTCCCCTGCCTGCCTCCAGCCTCCGTGTGCTCCAGGGTTGTGAG

CAGAGCAGGAAGGTCAGGTGAGAGTGGCTGTAGGAGGTCCTCCAGCCCGGGTGCGTGGGTGCACAGGTGCGTGGGTGTGTGGAACGGGTCTGCTCTGCCT

GCTTCTGTCTCTGTCTGGGTGTTTGAGTTCCAAAAAGTGTGTGGTGTTTGTTCCTCCTCATCCTCTTCTGAGACTGTTGATTTTAAACACTTGATTGTGA

ACGAAGAGCTTCTATGAAAACCCTCACCTTTCCATGTCCCAAAAACCAACACAAGTCCCTGGGGCGGGTGGAGAAGATGGTGGAGCCCCGTGAGACGGGG

CTTCTGTGTGACCCTTACTTCCTCTGCACACTGGGACCCTTGAGCCAAGGGCAGTCCCTACCAGGTGCCCAAGCCGCAAGTCTCAGGGGGCTTTTGTCTG

AGGACCTTCTTGGGGCCAGTCTCTGAGGACGCTGCCACCCTAGAGCACATGCATGCCCAGCCATTCTTCCTGCTTCTGGCCTCGGAGCTGCTTGTCTCCA

GATGCCCTCCTGAAACCATGAGAAGCTTCAGCCTTGCCTCACTGGCTTCCCCATCTGACCCCACCAGGTACCACACTGTCACCCAGTGTCCTTGATCTCC

TCTTGTTCCCCTTTCTGCTTGTAGCAGCCTCACTTGGCAAATGTAACGGCTCAGGTACCCTGGCTTCCTTCCCAGAAACAAGCCTTGCCTGTGCATCCTG

GAGAGTTAGGTCCTTCAGAAGGCCAGAGCTGGGACAAGCCTTGACCCGTTCTGCAGCCCTTAGAGCCTTCACACGTGAGCACTAGGCCATCTTAGCAGAA

CCCCCATCTGGCAGCACATGCCAAGTTTCAGGAGGATTGGGGGGAGGCGGGTGCAGGCTTGAGAAGAATCTGGGTGTGTGGGTATGTGTGCACATGTGCA

TGTGGGTGTGTGTGTGCACATGTGCATGTGGGTGTGTGTAAGTATGTGTGCACATGGGAGTGTGGGTGTGTGTGTGTGCACATGTGTGGGTGTGTGTGCA

CATGTTTGGATGTGTGCACATGTGCATGCCTGTTTCTTTTTGCCAGGGAGACAACTGAATTTGGGGCATTTTTCTACAAACACAGCCTCCTCTCCCCCTG

TATGGACTGGCTATAACCATAAGCCAGGCGCTTTCACCAAGATGGCTGGTGGCCAAGGTGGGCAGTAGGCATGAGCTTCCAGCAGGAAAGGACAAGAGAG

TAGGCAGGCTTACAGGTGCAGACTGAGTGCTTCTCCGCCTGCCCTCTTCCCCTTGTTTCCTTGGGTGAGTGTGGGGGGCAGCCTGCTGTCCCTCCCACCT

GCACAGTGATGCTGTCTGGTGGGGCCTCGTGGTGCCTAGGAGATGAAGATGAGGTTTTCCTTACCGTGTAAATGAATATTTGTATGATTAAATTAACACA

CACAAAAAAAAAAA
Translation
MEGMDVDLDPELMQKFSCLGTTDKDVLISEFQRLLGFQLNPAGCAFFLDMTNW - UNI6452 - - UNI13150 - WNLQAAIGAYYDFESPNISVP

SMSFVEDVTIGEGESIPPDTQFIKTWRIQNSG - UNI6766 - GAEAWPPGVCLKYVGGDQFGHVNMVMVRSLEPQEIADVSVQMCSPSRAGMYQGQW

RMCTATGLYYGD - UNI5299 - - UNI13302 - DVIWVILSVEVGGLLGVTQQLSSFETEFNTQPHRK - UNI13302 - - UNI21666 - 

GLHGPYPFGQS
Transcript ENSMUST00000075076
Sequence
GAGAGAGGAGCGAGCGGTGCGGTGCGGCGCGGCTCGGCGCGGCGCGCGCAGCCCATGAGGCGGTGAGAGGCCTGGGGCCTGTCTCGGAGCAGTGCGCGCG

GCGCCGGCCAGCAGCGGGCCGCCCTTCGTGGGCTCGGGCCCGGGCGCGGCGGCCGCCCGTGGAGAAGCAGGTCGGGGCGGTGGAAGCTGTGCGTCCGGGC

CCCCCGCCATGGAGGGCATGGACGTGGACTTGGATCCGGAGCTCATGCAGAAGTTCAGCTGCCTGGGCACCACAGACAAGGACGTGCTCATCTCCGAGTT

CCAGCGGCTACTCGGCTTCCAGCTCAACCCGGCCGGCTGCGCCTTCTTCCTGGACATGACCAACTG - UNI6452 - - UNI13150 - GAACTTAC

AAGCAGCGATTGGCGCCTATTATGACTTCGAGAGCCCAAATATCAGTGTGCCCTCCATGTCCTTTGTTGAAGATGTCACCATAGGAGAAGGGGAGTCAAT

ACCCCCTGATACCCAGTTCATAAAAACTTGGCGGATACAGAATTCTG - UNI6766 - GAGCAGAGGCCTGGCCTCCAGGGGTTTGTCTTAAATATGT

CGGGGGAGACCAGTTTGGACATGTGAACATGGTGATGGTGAGATCACTAGAGCCCCAAGAGATCGCAGACGTCAGCGTCCAGATGTGCAGTCCCAGCAGA

GCAGGCATGTACCAGGGACAGTGGCGGATGTGCACTGCTACTGGACTCTACTATGGAG - UNI5299 - - UNI13302 - ATGTCATCTGGGTGAT

TCTCAGTGTGGAGGTGGGTGGACTTTTAGGAGTAACGCAGCAGCTGTCATCTTTTGAAACGGAATTCAACACACAGCCACATCGCAAGGTAGAAGGAAAC

TTCAACCCGTTTGCCTCTCCCCAAAAGAACCGACAATCAGATGAAAACAACCTAACAGACCCTGGGGGTTCCGAGTTCGACTCGATCAGCAAAAATACAT

GGGCTCCTGTTCCTGAGCAAAGCGAGCAAGATCAGGATAGACTGTCACAGAGCTCTGTAAATCTGTCCCCCAGCAGTCCCGCAAACAACTTATCAGTAGT

GACTTACAGTAAGGTAGGTGCCCTCGGAGGAGGGGCAGGTGGTGGGCCCTGGGATTCCTGACACTTCTTCGTGGCAAACCTACAATGCTAGACCACCACT

GCCCAGAGCAGCTGTGGCTCCTTAACTGCTCAGCACTCCTGCCCGTAGTCACCATGAGTCAGCCGTCTTTCTTCCCCGTGTGAGTGCCCTGTGGCTGCTG

CTTCATCCCCATGTGTAATTCATTTCTGTCTCTGTTCTGACTCGGGTGTTGAAATCTGAGGCTATTTACCGTTAGTATTTTTAAAACTGTCAAAATATCA

TTATCAGTGCCTCCGGGGCAGGAGTATGCTGAGCTTCGTCATCTCAGCGCGCTATGCAGCGGGCTCCTGCTGTGCCTTCTCGCTCTGGGCGGGTTTATCC

TGAGTAAAGTGTCCAGCTCCGTTATTCTATCCTAA
Translation
MEGMDVDLDPELMQKFSCLGTTDKDVLISEFQRLLGFQLNPAGCAFFLDMTNW - UNI6452 - - UNI13150 - WNLQAAIGAYYDFESPNISVP

SMSFVEDVTIGEGESIPPDTQFIKTWRIQNSG - UNI6766 - GAEAWPPGVCLKYVGGDQFGHVNMVMVRSLEPQEIADVSVQMCSPSRAGMYQGQW

RMCTATGLYYGD - UNI5299 - - UNI13302 - DVIWVILSVEVGGLLGVTQQLSSFETEFNTQPHRKVEGNFNPFASPQKNRQSDENNLTDPGG

SEFDSISKNTWAPVPEQSEQDQDRLSQSSVNLSPSSPANNLSVVTYSKVGALGGGAGGGPWDS
Transcript ENSMUST00000114863
Sequence
GAGAGAGGAGCGAGCGGTGCGGTGCGGCGCGGCTCGGCGCGGCGCGCGCAGCCCATGAGGCGGTGAGAGGCCTGGGGCCTGTCTCGGAGCAGTGCGCGCG

GCGCCGGCCAGCAGCGGGCCGCCCTTCGTGGGCTCGGGCCCGGGCGCGGCGGCCGCCCGTGGAGAAGCAGGTCGGGGCGGTGGAAGCTGTGCGTCCGGGC

CCCCCGCCATGGAGGGCATGGACGTGGACTTGGATCCGGAGCTCATGCAGAAGTTCAGCTGCCTGGGCACCACAGACAAGGACGTGCTCATCTCCGAGTT

CCAGCGGCTACTCGGCTTCCAGCTCAACCCGGCCGGCTGCGCCTTCTTCCTGGACATGACCAACTG - UNI6452 - - UNI13150 - GAACTTAC

AAGCAGCGATTGGCGCCTATTATGACTTCGAGAGCCCAAATATCAGTGTGCCCTCCATGTCCTTTGTTGAAGATGTCACCATAGGAGAAGGGGAGTCAAT

ACCCCCTGATACCCAGTTCATAAAAACTTGGCGGATACAGAATTCTG - UNI6766 - GAGCAGAGGCCTGGCCTCCAGGGGTTTGTCTTAAATATGT

CGGGGGAGACCAGTTTGGACATGTGAACATGGTGATGGTGAGATCACTAGAGCCCCAAGAGATCGCAGACGTCAGCGTCCAGATGTGCAGTCCCAGCAGA

GCAGGCATGTACCAGGGACAGTGGCGGATGTGCACTGCTACTGGACTCTACTATGGAG - UNI5299 - - UNI13302 - ATGTCATCTGGGTGAT

TCTCAGTGTGGAGGTGGGTGGACTTTTAGGAGTAACGCAGCAGCTGTCATCTTTTGAAACGGAATTCAACACACAGCCACATCGCAAGGTAGAAGGAAAC

TTCAACCCGTTTGCCTCTCCCCAAAAGAACCGACAATCAGATGAAAACAACCTAACAGACCCTGGGGGTTCCGAGTTCGACTCGATCAGCAAAAATACAT

GGGCTCCTGTTCCTGAGCAAAGCGAGCAAGATCAGGATAGACTGTCACAGAGCTCTGTAAATCTGTCCCCCAGCAGTCCCGCAAACAACTTATCAGTAGT

GACTTACAGTAAG - UNI21666 - GGGCTCCACGGGCCTTACCCCTTCGGCCAGTCTTAAACGGGTGTCAGCAAGAAGAAAAACTAACAAAAGACAG

AAGGCCTGACTTTGGGGGGAGAGGGCAAGGGGTTCCTCTGGATTGCAGACCACATCGCACGGACCCCTGGCTCAGACCCCCACCTACCCCCCAATCACAG

AAGAAGAGGAAGAAAGAGACTAGTTTTGAGTGAACTCAGTATGCATGTGTGAATGCTGAACTGCAGGAGTGGTGTTGAGGCGACCGAGAAGATCCACGCA

GCCATCTTGGGTTTTGGTGATGACGTCAGTCTAATGAGTTGTTAGGTCACTTGGGAAGGGGAAGAAATTTAAATGGGGGAAAATAAGCCATCTTTTTAAA

CAAAAATTATTTTACCTACAGAGAGGTTGTAGTTTTGAGCACATGTTAGTTCCTCCCTCTTCCCGATGTTCATCTTCTAAGTAAGGGACAGCATGCTACA

GGACAGACCTGCTCTGGAAGCCTGTCATAGTAAGGCTGGCGTGGCACGTTTGGGGACTCTGCCAGTCGGAGTTGCTGGGCACATGCTGTGTACCACCGAC

TGCAGTCTGGCCCTGTTCTTAGTGGCATCTGCCAATGAGATATCACCTTCCCCCTCTCCTCTTTAATCTCTTGTTAAATTACCCCTTTGATATTGGTGTC

TGTCAGCGTTGGGGCTTCTTAGTATCAGGACCTCTCTGAGGTAAGGACTTTCCTGTGTGGCCACAGAAACCTGGGGGCATTCCGTTGCAGAGGTGTCCTC

TGTCACGTGTGTAACAGCTGGAACACAGTGGCCGTCTTCCCTCGGCTCTTGTTGGTGTGTGCATGTGCTGCGTGCACACCGGGTTGTATGGCGTCAGCAG

GTGTGAGCTGTCCCTTGCTTCTCTTGTCACACAGTGCCCCTTCCCCACGTGTCCTGTGGCTCCAGCCATTACAGAGTGAAGGTGCAACCCCATGTGGGAG

CCCCACTAGTGACCACTCCCTGAGAGGCCGCAATCAGGTGGGAATGAAAAGGCCTCCTCCAGCGGGGCAGGCTGCTCAGTGTGGGTGGCAAGTTGTAGCC

CAGCTGGAGGACAGGCCTTTGCTCCCTGGGCAGGTGCCCACTGGTGTCCCATGGAATCCACTCGGGTTGAAATGTGGATCTCTCCATGGGACTCTTTAAC

CAGGCTAGAACAGCTGTCTGCCAAAGATACAAGAATATGCAAAGTCCCTCCTCCTAACCCTCCTTCCCTCTAAGTCGGTGGCTTGAGAGCCGGGGATGTG

GATTTGGTGTGGTTACAGGGTCCCCTGCCTGCCTCCAGCCTCCGTGTGCTCCAGGGTTGTGAGCAGAGCAGGAAGGTCAGGTGAGAGTGGCTGTAGGAGG

TCCTCCAGCCCGGGTGCGTGGGTGCACAGGTGCGTGGGTGTGTGGAACGGGTCTGCTCTGCCTGCTTCTGTCTCTGTCTGGGTGTTTGAGTTCCAAAAAG

TGTGTGGTGTTTGTTCCTCCTCATCCTCTTCTGAGACTGTTGATTTTAAACACTTGATTGTGAACGAAGAGCTTCTATGAAAACCCTCACCTTTCCATGT

CCCAAAAACCAACACAAGTCCCTGGGGCGGGTGGAGAAGATGGTGGAGCCCCGTGAGACGGGGCTTCTGTGTGACCCTTACTTCCTCTGCACACTGGGAC

CCTTGAGCCAAGGGCAGTCCCTACCAGGTGCCCAAGCCGCAAGTCTCAGGGGGCTTTTGTCTGAGGACCTTCTTGGGGCCAGTCTCTGAGGACGCTGCCA

CCCTAGAGCACATGCATGCCCAGCCATTCTTCCTGCTTCTGGCCTCGGAGCTGCTTGTCTCCAGATGCCCTCCTGAAACCATGAGAAGCTTCAGCCTTGC

CTCACTGGCTTCCCCATCTGACCCCACCAGGTACCACACTGTCACCCAGTGTCCTTGATCTCCTCTTGTTCCCCTTTCTGCTTGTAGCAGCCTCACTTGG

CAAATGTAACGGCTCAGGTACCCTGGCTTCCTTCCCAGAAACAAGCCTTGCCTGTGCATCCTGGAGAGTTAGGTCCTTCAGAAGGCCAGAGCTGGGACAA

GCCTTGACCCGTTCTGCAGCCCTTAGAGCCTTCACACGTGAGCACTAGGCCATCTTAGCAGAACCCCCATCTGGCAGCACATGCCAAGTTTCAGGAGGAT

TGGGGGGAGGCGGGTGCAGGCTTGAGAAGAATCTGGGTGTGTGGGTATGTGTGCACATGTGCATGTGGGTGTGTGTGTGCACATGTGCATGTGGGTGTGT

GTAAGTATGTGTGCACATGGGAGTGTGGGTGTGTGTGTGTGCACATGTGTGGGTGTGTGTGCACATGTTTGGATGTGTGCACATGTGCATGCCTGTTTCT

TTTTGCCAGGGAGACAACTGAATTTGGGGCATTTTTCTACAAACACAGCCTCCTCTCCCCCTGTATGGACTGGCTATAACCATAAGCCAGGCGCTTTCAC

CAAGATGGCTGGTGGCCAAGGTGGGCAGTAGGCATGAGCTTCCAGCAGGAAAGGACAAGAGAGTAGGCAGGCTTACAGGTGCAGACTGAGTGCTTCTCCG

CCTGCCCTCTTCCCCTTGTTTCCTTGGGTGAGTGTGGGGGGCAGCCTGCTGTCCCTCCCACCTGCACAGTGATGCTGTCTGGTGGGGCCTCGTGGTGCCT

AGGAGATGAAGATGAGGTTTTCCTTACCGTGTAAATGAATATTTGTATGATTAAATTAACACACACAAAAAAAAAAACCCCGCCTTT
Translation
MEGMDVDLDPELMQKFSCLGTTDKDVLISEFQRLLGFQLNPAGCAFFLDMTNW - UNI6452 - - UNI13150 - WNLQAAIGAYYDFESPNISVP

SMSFVEDVTIGEGESIPPDTQFIKTWRIQNSG - UNI6766 - GAEAWPPGVCLKYVGGDQFGHVNMVMVRSLEPQEIADVSVQMCSPSRAGMYQGQW

RMCTATGLYYGD - UNI5299 - - UNI13302 - DVIWVILSVEVGGLLGVTQQLSSFETEFNTQPHRKVEGNFNPFASPQKNRQSDENNLTDPGG

SEFDSISKNTWAPVPEQSEQDQDRLSQSSVNLSPSSPANNLSVVTYSK - UNI21666 - GLHGPYPFGQS

For any suggestions or comments, please send an email to unitrap@crg.es