Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000056724 (Nbeal2)
Chromosomal location
Chr 9: 110527299 - 110556469 (-)
Description
neurobeachin-like 2 Gene [Source:MGI Symbol;Acc:MGI:2448554]
UniGene
Mm.335481 
MGI
MGI:2448554 
Uniprot/SWISSPROT
Q6ZQA0 
Uniprot/SPTREMBL
B2RXS1 Q8BTE2 
Human Ortholog
ENSG00000160796 (AC094020.2)
Omim not available
UniTrap UNI25366
Vector Insertion
Chr 9: 110547223 - 110556400
Public Clones not available
Private Clones OST186527 (lexicon)
Severity of mutation (?) Insertion after 1% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI38165
Vector Insertion
Chr 9: 110535480 - 110536702
Public Clones (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 52% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000093780
Sequence
CCAGAGCCCGGTCAGGCCATGGCCGCCTCGGAGCGGCTCTACGAGTTGTGGCTGCTCTACTACGCGCAG - UNI25366 - AAGGACCTTGGTTACCT

GCAGCAATGGCTGAAGGCCTTTGTGGGTGTCTTCGAGAAGACTATCTCGTTATCCTCCCTGGAACCTCGAAG GCCAGAGGAGGCAGGTGCGGAAGTGCC

TCTGCTACCCCTAGATGCTCTACATGCACTAGCGGAGCAGCTGGACCAGGACGACCTGGATCAAGCCCTGCTGTTGCTGAAGCTCTTTATCATCCTCTGC

AG GAACCTAGAGAACGTAGAGGCTGGTTGGGGCCAGGTACTGGTGCCCCGTGTGCTGGCGTTGCTCACTGTATTGATGGCTGAG CTGAAAGGATCCTC

ACAGGAGAGCCATGGGACCCAGCTAGAGAACGTGGCCCTGCATGCCCTGCTCCTTTGTGAAGGGCTCTTTGACCCTTACCAGACTTGGCGGCGCCAGCTC

ACTGG GGAAGTCATCAGCTCCAAGGAGAAGAGCAAATACAAGTTCCCTCCGGCCGCCTTGCCCTGTGAATTTGGAGCCTTCTTCCAAG AGAACCTGCA

GGATGCAGAGCGTTTGCCTCCCACGTTGCTGTTGCGGCTCATCCACCTCTTTGGTGCCATCCTTGCAGGAGGAAAG GCGAATGGGCAGATGGCTGTGAG

TGCTGGCTCTGTGCAGGGACTGCTAGGTGTGGTGCGGGGCTGGGGCCGTGGCCCTGCTCAGGACCCCCAGCAGGTGCCACTGGCTCTGAGAGCACTGGTG

GGTGCAGTGCACGTTCTGCATGCTAGCCGAGCACCACCCCGAGGACCAGAACTGCGTACCCTGCTTGAGGGTTACTTCCACATTCTCAATGCTGACTGGC

CAACTAGTCCAAGTTCAAGCCCCGAAGAGGCCCTTGTCACCCTGCGGGTCAGCATGCTCG ATGCTATCCCCATGATGCTGGCGTGTGAGGACCGGCCAG

TGCTACAAGCCACCTTCCTTAGCAACAATTGCTTTGAGCATCTTATTCGCCTCATCCAGAACAGCAAG CTTTACCTGCAGGCCCGGGCGCCCCCTGAGG

GGGACAGTGACCTGGCTACCTGGTTACTGACTGAGCCCGATGTCCAGAAG GTGCTTGACCAGGACACCGATGCCATCGCAGTGCACGTGGTCAGAGTGC

TGACCTGCATCATGAGTGGCTCCCCTTCGGCCAAG GAGGTGTTCAAGGAGCGCATTGGCTACCAGCACCTGCAGGAGGTCCTGCAGAGCCACGGACCCC

CTACCCACAGGCTGTTGCAGGAATTGCTCAACATG GCTGTGGAGGGTGACCACAGCATGCACCCACCTCCACCAATCCGCAACGAGCAGCCAGTGCTGG

TGCTGATGCAGTGGCTACCAGCACTGCCCACAGCTGAGCTGCGCCTCTTCCTGGCACAACGCCTCTGGTGGCTCTGTGACAGCTGCCCTGCCAGTCGCAC

CACCTGTGTGCAAGCAGGCCTGGTGGGCTACCTGTTAGAGACACTTAACACGGGGACAGCCCTGGGAGCCCGCTGCCAGGAGCAGCTGTTAGCCTTGCTG

CAAGCTCTGGGTCGAGTGTCACTACGGCCCTTGGAGCTGCGTCGCCTGCTGCGCCCCCCACCGGGGCTGGACTCAGAGTCAAGTGGAAATGAATCTCAGA

AGGCTCGCCATGCAGGCGCCGTCATCCGGGCACTGTCGGGCATGGCCCGGCACCGGGGTCCTGCACGTGCCCTGCGCTACTTTGACCTCACGCCCAGCAT

GGCTGGCATCATGGTGCCGCCCGTGCAGCGGTGGCCAGGAGCCGGCTTTACCTTCCATGCCTGGCTGTGTCTACAATCGTCAGAGGCGGTTCCTACCTCA

GCTCCCAGCCGGCCCCTCCAGCGGAAACAACTGTACAG CTTCTTCACCAGCAGTGGCTCAGGGTTCGAAGCCTTCTTCACGGCAGCTGGCACCCTGGTG

GTGGCCGTGTGCACACGGAAGGAGTACGTGACCGTGAACTTGCCCGAAGTGTCCTTCGCGGATTCTGCCTGG CACTGCGTGGCCATTGTGCATGTGCCC

GGGCGCCGACCCTTCAGTCAGAACCTGGTCAATGTCTTCAAAGATGGCCATCTGGTCAAGACAGTACCTTTTCGCTTTCCCTCCCTCAGTGAG CCTTTC

TCCTCCTGCTGTATTGGTTCTGCTGGGCACCGCACAACGACAACCACCACAGGGCTTCCCGCGTCATCAGTCTCCACAGCCTTGGCTCACACTCACCCTT

CCCTCACCCGCTCCCAGTCAGTCCCAGCCTCCACAGGCCTGGGCTGGGGGCCTGGACTGGGGACCCCTCTGCAGGAGGGCAGCGTCAGCTCTACCCTCGC

AGGCACCCAGGACACTCGGTGGGGAAGCCCCACATCTCTGGAGGGTGAGCTGGGGGCTGTAGCCATCTTCCATGAAGCCCTGCAACCATCTGCCCTAAGG

GTCCTGTGTAGCCTGG GGCCCAATGAGCCAGCACCCTTCAAGCCTGAGGGTGAACTACATGAGTTTGGCACCAAGTTGCTCCTCCATTATTCACCGCAG

 GCCTGTAAGAACAATATCTGTCTGGACCTGTCCCCTGGCCATGGGCTGGATGGCCGTCTGACAGGACATAGGGTGGAGACATGGGACGTGAAG GATGT

GGTGAACTGCGTAGGGGGCATGGGTGTTCTGCTGCCCTTGCTGGAGCGAGTGGCTGTGCAGCCCCAGGAGGCCGAGGCCGGCCCGTGTGAAACACACGAC

CTCGTAGGACCTGAGCTGACCTCAGGCCGCAACACTCAGGGCCTGCTTCTCCCCCTGGGCAAGTCCTCAG AGGACCGGATGGAGAGGAACGCAGTGGCT

GCCTTTCTCCTGATGCTTCGGAACTTCCTGCAGAACCACACCGTGAATCAGGAGAGCCTGGTGCAGTGCCAGGGTCCTGCCATCATAGGGGCTCTCCTGC

GCAAG GTCCCCAGTTCGGCCATGGATATGAATGTGCTCATGTCTGCCCAGCTGCTGATGGAGCAGGCGGCTGCTGATGGCGGTGGGCCCCTCCTCTACC

TGCTCTATCAGCACCTGCTCTTCAACTTTCACCTCTGGACCCTCAGTGACTTCGCTGTGCGCCTGG GTCACATCCAGTACATGTCTAGCATGGTCCGTG

AGCACAGACAGAAACTTCGGAAGAAGTACGGAGTTCAGTTCCTCCTCGATGCTCTGCGCACGCACTACAG CCCGCAGCGCGAGCGCCCCCTAGCGGCAG

ACGACCTGCGTACAGTACAGACTTCCCTTTTGGGTCTGGTGCGTGAGTTCTTGGTTAGGAACTTCTCGGTGGAAGACATGCAGGTTGTATTGAACTTTTT

GGCAGCTACCGGTGACGATGGCCAG GTGGTGGGCACCCTGGAGCTGTTGCTAACCCTGCTTCAGGGTTCTCCAGTGCAAGACCCCTTGGCCGCCTTCCT

GCTGGAGCTGGGGAACCTTGAGGTGCTGCTCGCACTGCTGGTGCGGCCAAAGTCAACGCCCCTTTTGACCGACAGGGTCTGCAAG ATCTTGCGAAGACT

GCAGCAGAATGAGCGGTTACCCGAGCGGAACCGCCAGAGGATACGGCTGCACGACTGTGGTCTCCAGGGTCTTGTTGCTAGCTTGTCGGAAGAGAGCATC

TCTCCCCAGCTCTGCCAGGGCCTTTATAAGCTGTTTGTAGGGACAG ACTGCCTGAATCTCTCAGATTTGTTGGCTGTTGTACAGCTGTCCCTCCAGGCT

GACCTCAGTGTCCGCCTAGACATCTGCCGTCAG CTCTTTTACCTCATCTACGGACAGCCAGACGTCGTTCGGCTGCTGGCCCGACAAGCTGGCTGGCAG

GATGTGCTGACGCGGCTGTATGTCCTCGAGGCTGCCACAGACAGTAGTCCCCCACGCTTCCTCCCAGAGCTGCCGATCTCTTCAGAGCTGGCCCTATCTC

CGCCGCCCACTGAGTTGCCCGCTGACTCTTCTGACGTCTTCCTGCCTTCAGAGTCCCCTTGCCCTGACCAGGATGCTTTCTACCAGGCCCTCTCCCCGTT

CAGTACACCCTTTGACCTGGGTTTGGAACGGGCCAGCATTGGCTCGGGCAATACCGCTGGTGGCGGCAGCAGCAATGGGACTGTTACTCCGGCCAGCCAG

CCTGGCACACCCTCCCCGCTGGATGGGCCACGGCCCTTCCCAACTGCCCAAGGCCGCCACAGCTCCAGTCTCTCCAATGTGCTGGAAGATGGCAGCCTGC

TAGAACCCAACATCAGTGGGGATGATACCTCGAACACGAGCAACCCCCAG CAAACCCCTGAAGAGGAGCTGTGCAACTTACTCACCAACGTGCTATTCT

CAGTGACGTGGCGGGGCGTGGAGGGCAGTGCGGAGGCCGCCTGGCGGGAACGTGGCCAGGTCTTCTCCGTGCTTACCCAGCTGGGGGCCTCTGCCACACT

TGTGCGACCACCAGACTGCATCAAGCGCAG CCTCCTAGAGATGATGTTAGAGTCAGCCCTGACCGACATCAAGGAGGCTCCCCCAGGAGGCCTGGCCAA

CCTTTCCCAGCAGGCACTGTGGCTGCTCCGTTTACTGCAGGATTTCCTGTGTGCTGAGGGCCACGGTAACCAGGAGCTGTGGAGTGAGAAG CTCTTTGA

AGGTGTGTGCAACCTGCTTGATCGCCTGGGAGCCTGGCCACATCTCGCCAATAGCACAGCAGATCTCCGGGAGATGGCGCAGATCGGCTTACGTCTTGTG

CTTGGATACATCCTATTGGAAGACCCACAG CTGCATGCCCAGGCCTATGTGAAGCTGCACACACTGCTGCAGACCGCAGTGCCGACCCGCCGGGAGGAG

GCGTGCTACGTGCTCTCCAAGCTGGAGGCAGCGCTCAGTCGGGCGCTGACCACCTCGTCTTCCGAGACTGAGCATGCGTCTACAGCCGTGGCAGCCTCTG

AGCGCTGTTCGTGGTTGGTGCCACTGGTCCGCACGCTGCTGGACCGTGCATATGGGCCCCTGGGACTGCAGTGGGGGCTGCCCTCCTTACCACCCACCAA

TGGAAGCCCCACCTTCTTTGAGGACTTCCAGGCTTTTTGTGCCACAGCCGAATGGCGCCACTTCATCGACAAGCAG GTTCAGCCAACTATGTCAAAGTT

TGAAATGGACACATATGCTAAGAGCCATGACCTCATGTCAGGCTTCTGGAATGCCTGCTACGACACACTCATGAGCAGCGGGCAGCGGCATCAGCGGGAC

CGTATCCAGAGTCGGCGGGCCTTCAAG GAGCTGGTCCTAGAACCTGCCCAGCGCAGGGCTCGCGTGGAGGGATTGCGCTATGCATCTGTACTGAAGCAG

CAGGCAGCGCAGCACTCGACGGCACTGCTCCACTGGGGGGCGCTGTGGCGCCAGCTTTCTAGCCCCTGTGGGGCCTGGGCACTAAG GATCCCTCCAGCC

CCCCACTGGAAGCTGTCTAGTGCAGAGACATACTCCCGTATGCGACTAAAACTGGTACCCAATCATCACTTTGACCCTCACCTGGAAGCTAGCGCCCTAC

GTGACAATCTCG GTGAAGCTCCCATGACACCCACTGAGGAGACCTCACTGCCTCTGGCAGTGACCAAAGAGGCCAAAATCAGTGCCCCTCCGGAGGAGC

TGCCTGAGGAGCAGTTAGGGGAAGAGGACCTGGCTGCACTGGAGTCCCT GATGGAGGAGGCGGCCGAGCTAGATGAGAAACGCGAGAAGCTTGTGTTGT

CGGCTGAGTGCCAGCTCGTCACGGTGGTGGCTGTGGTCCCGGGACTCTTAGAGATCACCACACAGCACGTGTATTTCTATGACGGCAGTACGGAACGCGT

GGAAACAGAGGAAG GCATCGGCCATGACTTCCGGCGCCCCTTGGCCCAGCTGCGTGAGGTCCACCTGCGGCGTTTCAACCTGCGGCGTTCGGCGCTCGA

ACTCTTCTTCATTGACCAGTCCAACTACTTCCTCAACTTCCCACACAAGGTGGCCGCGTCCTCTGCGTCATCCCCTTGCCAGGCTCCCAGGCCCCAGCTC

TACCCTATCCCATCCCACACCCAGCTACGGAACCAGGTGTACTCATTGCTTCTGCGCCTAAGGCCACCCACCCAAGGCTACCTAAGCAGCCGCTCCCCAC

TGGAGATGCTTCGTGCCTCGGGACTTACCCAG AAATGGGTACAGCGAGAGATATCCAACTTTGAGTACCTCATGCAACTCAACACAATCGCAGGGCGCA

CCTATAATGACCTGTCTCAGTACCCTGTG TTCCCCTGGGTCTTGCAGGACTATGTGTCCCCAGTCTTGGACCTCAGCAATCCAGCTGTCTTCCGGGACC

TGTCCAAACCCATCGGTGTGGTGAATCCCAAGCATGCCCAGCTTGTGAGGGAGAA ATATGAGAGCTTTGAGGACCCAGCAGGCACAATCGACAAGTTCC

ACTATGGCACACACTATTCTAACGCAGCGGGCGTGATGCACTACCTCATCCGCGTGGAGCCCTTCACGTCCCTGCATGTCCAGCTACAGAGCGGCCG CT

TCGACTGCTCTGACCGGCAGTTCCACTCGGTGGCAGCAGCCTGGCAGGCACGGCTGGAGAGCCCCGCCGACGTGAAGGAGCTCATTCCGGAGTTTTTCTA

CTTTCCTGACTTCCTGGAGAACCAGAATG GCTTTGACCTGGGCTGCCTCCAGTTGACCAACGAGAAGGTGGGTGATGTGGTGCTGCCCCCGTGGGCCGG

CAGCCCCGAGGATTTCATCCAGAAACACCGCCAGGCTCTG GAGTCAGAGTATGTGTCCACCCACCTGCACGAATGGATCGACCTCATCTTTGGCTATAA

GCAGCGGGGTCCAGCGGCCGAGGAGGCCCTCAATGTCTTCTATTACTGCACTTACGAAG GGGCGGTTGACCTGGACCACGTGGCAGATGAACGGGAGCG

GAAGGCTCTGGAAGGCATCATCAGCAACTTCGGGCAGACTCCTTGTCAGCTGCTGAAG GAGCCACACCCACCCCGGCTCTCGGCTGAGGAAGCAGCCAA

TCGCCTCGCCCGGCTGGACACTAACTCACCAAGCATCTTCCAGAACCTCAACCAACTCAAGGCCTTTTTCGCTGAG GTTGTCAGTGAGGCTGTACCTCT

GGTCTTAGCTCTGGTTCCTCACCGACAGTCACACTCCTTTATCACCCAGAGCTCCTCGGACATGTTG GTGACTGTAAGTGCCAGTGGGCTGCTGGGCAC

TCATACCTGGCTGCCCTATGACCGGAACATCAATAACTACTTTACCTTCAGCAAAGATCCCACCATGGGGAGCCCCAA GGTGCAGAAACTACTGAGTGG

GCCCTGGGTCTCAGACAGTGGCGTGAGTGCACAAGCACTAGCAGTAGCTCCTGACGGAAAGCTGCTCTTCAGTGGTGGCCACTGGGATGGCAGCCTACGA

GTGACTTCACTACCCCGTGGCAGGCTGTTGAATCAGCTAAGCCGACACCTTG ATATAGTGACCTGCCTTGCACTGGACACCTGCGGCATCTACCTCATC

TCCGGCTCCCGGGATACCACGTGCATGGTGTGGCGTCTTCTGCAGCAG AGCGGTCTGTCAGCAGGGCTGGCACCAAAGCCTGTGCAGGTCTTATACGGA

CATGTAGCTGCAGTGAGCTGTGTGGCCATCAGCACTGAACTTGACATGGCCGTGTCTGGATCCGAG GATGGGACTGTGATCATACACACTGTACGTCGA

GGCCAGTTTGTGGCAGCATTAAGGCCTCCAGGTGCCACACTGCCTGGACCTATATCGCACTTAGCACTGGGGGCTGAAGGCCAGATTGTTGTACAAAGCT

CTGCTTGTGAACGTCCTGGGGCCCAG GTCACCTACTCCTTGCACCTGTATTCAGTGAATGGGAGGTTGCGGGCTTCAGTGACCCTGACGGAGCAGCCCA

CAGCCCTGACTGTGGCAGAAGACTTTGTTCTGCTGGGCACCGCTCAGTGCTCTCTACATATCCTCCACTTGAACAA ATTGCGGCCCGCCGTGCCTCCCC

TGCCCATGAAAGTGCCGGTCCACAGTGTGTCTGTGACCAAGGAGCGCAGTCATGTGCTGGTGGGCCTGGAAGATGGCAAATTGATCGTTGTGGGCGCTGG

GCAGCCTTCTGAG GTACGCAGCAGCCAGTTCGCGCGGAGGCTGTGGCGCTCCTCGCGGCGAATCTCCCAGGTGTCCTCTGGGGAGACTGAATACAATCC

TGGCGAGGCTCGCTGAACCTAGAGTCTAGGCGCTCAGACATCAGACCCGGCCCGAGCCTGATTCTCTGCCCAGGAGACTACTGCACCAGGGGGTGGGCGG

GGCCCACCCTCCAGCTCAGGGATTGGTAGATGGCATCACCAGGAAGTCCCGCCCCTCGCCGGCTGAGGGGAGACCTAGCGTCGGCCTCTGAGGCCGCTGC

TGCATATTTTGCACAATCTGGGGTGGGAGGGAATCCCTACTTTCAAATCCCACGTCCCAGTGAAAGCACAAAGACCACCTGTGGCCTTAATCCTCAAAGG

TGACTATCGCTGCCCATTCTCAGCAATAAACGTGGCCTAGTTTTGT
Translation
PEPGQAMAASERLYELWLLYYAQ - UNI25366 - KDLGYLQQWLKAFVGVFEKTISLSSLEPRR RPEEAGAEVPLLPLDALHALAEQLDQDDLDQA

LLLLKLFIILCR RNLENVEAGWGQVLVPRVLALLTVLMAE LKGSSQESHGTQLENVALHALLLCEGLFDPYQTWRRQLTG GEVISSKEKSKYKFPPA

ALPCEFGAFFQE ENLQDAERLPPTLLLRLIHLFGAILAGGK ANGQMAVSAGSVQGLLGVVRGWGRGPAQDPQQVPLALRALVGAVHVLHASRAPPRGP

ELRTLLEGYFHILNADWPTSPSSSPEEALVTLRVSMLD DAIPMMLACEDRPVLQATFLSNNCFEHLIRLIQNSK LYLQARAPPEGDSDLATWLLTEPD

VQK VLDQDTDAIAVHVVRVLTCIMSGSPSAK EVFKERIGYQHLQEVLQSHGPPTHRLLQELLNM AVEGDHSMHPPPPIRNEQPVLVLMQWLPALPTA

ELRLFLAQRLWWLCDSCPASRTTCVQAGLVGYLLETLNTGTALGARCQEQLLALLQALGRVSLRPLELRRLLRPPPGLDSESSGNESQKARHAGAVIRAL

SGMARHRGPARALRYFDLTPSMAGIMVPPVQRWPGAGFTFHAWLCLQSSEAVPTSAPSRPLQRKQLYS SFFTSSGSGFEAFFTAAGTLVVAVCTRKEYV

TVNLPEVSFADSAW HCVAIVHVPGRRPFSQNLVNVFKDGHLVKTVPFRFPSLSE PFSSCCIGSAGHRTTTTTTGLPASSVSTALAHTHPSLTRSQSVP

ASTGLGWGPGLGTPLQEGSVSSTLAGTQDTRWGSPTSLEGELGAVAIFHEALQPSALRVLCSLG GPNEPAPFKPEGELHEFGTKLLLHYSPQ ACKNNI

CLDLSPGHGLDGRLTGHRVETWDVK DVVNCVGGMGVLLPLLERVAVQPQEAEAGPCETHDLVGPELTSGRNTQGLLLPLGKSSE EDRMERNAVAAFLL

MLRNFLQNHTVNQESLVQCQGPAIIGALLRK VPSSAMDMNVLMSAQLLMEQAAADGGGPLLYLLYQHLLFNFHLWTLSDFAVRLG GHIQYMSSMVREH

RQKLRKKYGVQFLLDALRTHYS SPQRERPLAADDLRTVQTSLLGLVREFLVRNFSVEDMQVVLNFLAATGDDGQ VVGTLELLLTLLQGSPVQDPLAAF

LLELGNLEVLLALLVRPKSTPLLTDRVCK ILRRLQQNERLPERNRQRIRLHDCGLQGLVASLSEESISPQLCQGLYKLFVGTD DCLNLSDLLAVVQLS

LQADLSVRLDICRQ LFYLIYGQPDVVRLLARQAGWQDVLTRLYVLEAATDSSPPRFLPELPISSELALSPPPTELPADSSDVFLPSESPCPDQDAFYQA

LSPFSTPFDLGLERASIGSGNTAGGGSSNGTVTPASQPGTPSPLDGPRPFPTAQGRHSSSLSNVLEDGSLLEPNISGDDTSNTSNPQ QTPEEELCNLLT

NVLFSVTWRGVEGSAEAAWRERGQVFSVLTQLGASATLVRPPDCIKRS SLLEMMLESALTDIKEAPPGGLANLSQQALWLLRLLQDFLCAEGHGNQELW

SEK LFEGVCNLLDRLGAWPHLANSTADLREMAQIGLRLVLGYILLEDPQ LHAQAYVKLHTLLQTAVPTRREEACYVLSKLEAALSRALTTSSSETEHA

STAVAASERCSWLVPLVRTLLDRAYGPLGLQWGLPSLPPTNGSPTFFEDFQAFCATAEWRHFIDKQ VQPTMSKFEMDTYAKSHDLMSGFWNACYDTLMS

SGQRHQRDRIQSRRAFK ELVLEPAQRRARVEGLRYASVLKQQAAQHSTALLHWGALWRQLSSPCGAWALR RIPPAPHWKLSSAETYSRMRLKLVPNHH

FDPHLEASALRDNLG GEAPMTPTEETSLPLAVTKEAKISAPPEELPEEQLGEEDLAALESL LMEEAAELDEKREKLVLSAECQLVTVVAVVPGLLEIT

TQHVYFYDGSTERVETEEG GIGHDFRRPLAQLREVHLRRFNLRRSALELFFIDQSNYFLNFPHKVAASSASSPCQAPRPQLYPIPSHTQLRNQVYSLLL

RLRPPTQGYLSSRSPLEMLRASGLTQ KWVQREISNFEYLMQLNTIAGRTYNDLSQYPV FPWVLQDYVSPVLDLSNPAVFRDLSKPIGVVNPKHAQLVR

EK KYESFEDPAGTIDKFHYGTHYSNAAGVMHYLIRVEPFTSLHVQLQSGR RFDCSDRQFHSVAAAWQARLESPADVKELIPEFFYFPDFLENQNG GF

DLGCLQLTNEKVGDVVLPPWAGSPEDFIQKHRQAL ESEYVSTHLHEWIDLIFGYKQRGPAAEEALNVFYYCTYEG GAVDLDHVADERERKALEGIISN

FGQTPCQLLK EPHPPRLSAEEAANRLARLDTNSPSIFQNLNQLKAFFAE VVSEAVPLVLALVPHRQSHSFITQSSSDML VTVSASGLLGTHTWLPYD

RNINNYFTFSKDPTMGSPK KVQKLLSGPWVSDSGVSAQALAVAPDGKLLFSGGHWDGSLRVTSLPRGRLLNQLSRHLD DIVTCLALDTCGIYLISGSR

DTTCMVWRLLQQ SGLSAGLAPKPVQVLYGHVAAVSCVAISTELDMAVSGSE DGTVIIHTVRRGQFVAALRPPGATLPGPISHLALGAEGQIVVQSSAC

ERPGAQ VTYSLHLYSVNGRLRASVTLTEQPTALTVAEDFVLLGTAQCSLHILHLNK KLRPAVPPLPMKVPVHSVSVTKERSHVLVGLEDGKLIVVGAG

QPSE VRSSQFARRLWRSSRRISQVSSGETEYNPGEAR

For any suggestions or comments, please send an email to unitrap@crg.es