Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000056755 (Grm7)
Chromosomal location
Chr 6: 110595862 - 111517224 (+)
Description
glutamate receptor, metabotropic 7 Gene [Source:MGI Symbol;Acc:MGI:1351344]
RefSeq_dna
NM_177328 
RefSeq_peptide
NP_796302.2 
UniGene
Mm.240881 
MGI
MGI:1351344 
Uniprot/SWISSPROT
Q68ED2 
Uniprot/SPTREMBL
Q80T39 Q8BKE3 Q8BKZ1 
Human Ortholog
ENSG00000196277 (GRM7)
Omim not available
UniTrap UNI33629
Vector Insertion
Chr 6: 111309075 - 111445646
Public Clones IST11530H12 (tigm) IST12040D12 (tigm) IST12040E2 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 89% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000071076
Sequence
ATGGTCCAGCTGGGGAAGCTGCTCCGCGTCCTGACTTTGATGAAGTTCCCCTGCTGCGTGCTGGAGGTGCTCCTGTGCGTGCTGGCGGCGGCGGCGCGCG

GCCAGGAGATGTACGCCCCGCACTCGATCCGGATCGAGGGGGACGTCACCCTTGGGGGGCTGTTCCCAGTGCACGCCAAGGGTCCCAGCGGAGTGCCCTG

CGGCGACATCAAGAGGGAGAATGGGATCCACAGGCTGGAAGCTATGCTTTATGCTCTCGACCAGATCAACAGCGATCCCAACCTGCTGCCCAACGTAACG

TTAGGCGCGCGGATCCTGGACACTTGTTCCAGGGACACTTATGCGCTCGAACAGTCGCTCACTTTCGTCCAGGCGCTTATCCAGAAGGACACCTCCGACG

TGCGTTGCACCAACGGAGAGCCCCCGGTTTTCGTCAAGCCAGAGAAAGTAGTTGGAGTGATTGGGGCTTCGGGGAGCTCCGTCTCCATCATGGTAGCCAA

CATCTTGAGGCTTTTCCAG ATACCTCAGATTAGTTATGCATCCACGGCTCCTGAACTCAGTGATGACCGTCGCTATGACTTCTTCTCTCGCGTGGTCCC

ACCTGATTCCTTCCAAGCCCAAGCTATGGTAGACATTGTAAAGGCATTGGGCTGGAATTATGTATCTACTCTTGCATCTGAAGGAAGCTATGGAGAGAAA

GGTGTGGAGTCCTTCACACAAATTTCCAAAGAAGCAG GTGGACTCTGCATTGCCCAGTCCGTGAGAATTCCCCAAGAACGCAAAGACAGGACCATTGAC

TTTGATAGAATTATCAAACAGCTCTTGGACACCCCCAACTCCAGGGCTGTCGTGATTTTTGCCAACGATGAGGATATAAA GCAGATCCTTGCAGCAGCC

AAAAGAGCTGACCAAGTAGGACATTTTCTCTGGGTTGGGTCAGACAGCTGGGGTTCCAAAATCAACCCACTGCATCAGCATGAAGATATTGCAGAAGGAG

CCATCACCATCCAACCTAAGAGAGCGACTGTGGAAG GATTTGATGCTTACTTCACATCCCGGACACTTGAAAACAACAGGAGAAATGTATGGTTTGCCG

AATACTGGGAAGAAAACTTCAACTGCAAGTTGACAATTAGTGGATCCAAAAAAGAAGACACGGATCGCAAATGCACAG GACAGGAGCGAATTGGAAAAG

ACTCTAATTATGAGCAGGAGGGTAAAGTACAGTTTGTGATCGATGCTGTCTATGCCATGGCACATGCCCTTCATCACATGAATAAGGATCTGTGTGCTGA

CTACCGGGGAGTGTGCCCAGAAATGGAGCAAGCAGGGGGCAAGAAGTTGTTGAAGTATATCCGCAATGTTAACTTCAATG GTAGTGCTGGAACCCCAGT

GATGTTTAACAAAAATGGTGATGCTCCAGGACGATATGACATCTTCCAGTACCAGACAACAAACACTACCAATCCTGGTTATCGTCTCATTGGGCAGTGG

ACAGATGAACTGCAGCTCAAT ATAGAGGACATGCAGTGGGGCAAAGGAGTCCGGGAGATCCCACCCTCTGTGTGCACATTGCCATGCAAGCCTGGGCAG

AGGAAGAAGACACAGAAGGGAACCCCTTGCTGCTGGACTTGTGAGCCCTGTGATGGATACCAGTATCAATTTGATGAGATGACATGTCAGCATTGTCCCT

ATGACCAGAGGCCCAATGAGAACCGAACTGGCTGTCAGAACATCCCAATCATCAAACTGGAGTGGCACTCCCCCTGGGCTGTAATTCCTGTCTTCCTGGC

AATGTTGGGGATCATTGCCACCATCTTTGTCATGGCAACCTTCATCCGCTACAATGATACACCCATCGTCAGGGCATCTGGGCGGGAACTCAGCTATGTT

TTATTGACAGGCATCTTTCTCTGCTATATCATCACCTTCCTAATGATTGCCAAGCCAGATGTGGCAGTGTGTTCCTTCCGACGTGTCTTCTTGGGGTTGG

GTATGTGTATTAGTTATGCAGCCCTTTTAACAAAAACCAATCGGATTTATCGCATATTCGAGCAGGGCAAGAAATCGGTGACAGCTCCCAGACTCATAAG

CCCAACATCACAACTGGCAATTACCTCCAGTTTAATATCGGTGCAACTTCTAGGTGTCTTTATTTGGTTTGGGGTTGACCCACCCAACATCATCATAGAC

TACGATGAGCATAAGACAATGAACCCAGAACAAGCCAGGGGAGTTCTCAAATGTGACATCACAGACCTTCAGATCATTTGTTCTTTGGGATATAGCATTC

TTCTCATGGTCACATGTACTGTGTATGCCATCAAGACTCGGGGTGTACCAGAGAATTTTAATGAAGCCAAGCCCATTGGATTCACTATGTACACGACTTG

TATCGTATGGCTTGCCTTCATCCCAATATTTTTTGGCACAGCGCAATCAGCAGAAAAG - UNI33629 - CTCTACATACAAACCACCACGCTTACAA

TCTCCATGAACCTAAGTGCATCAGTGGCGCTGGGGATGCTATACATGCCGAAAGTGTACATCATCATTTTCCACCCTGAACTCAATGTCCAGAAACGGAA

GCGAAGCTTCAAGGCCGTAGTCACAGCAGCCACCATGTCATCGAGGCTGTCACACAAACCCAGTGACAGGCCCAATGGTGAGGCAAAGACAGAACTTTGT

GAAAATGTAGACCCAAACA GCCCTGCTGCAAAAAAGAAGTATGTCAGTTATAATAACCTGGTTATCTAACCTGTTCCATCCCATGGAACCACAGAGGAG

GAAGACCTTGAATTATTCTGTCACCCAGCCTGGCGTAGGACTCTTTTGGTCCTGCCTGCTTCCTATCTCTGGAGGAGCTTCCCCACGCGGGAGAGCAATG

GCAGAGGATCCACACATCCTGAACAGCTGCTTTATGAGACACCTTTACTTTATCTTGGCTTAAGAAGTCATTGGCATCAGCACTGCCATCTTGGCTGCAA

TTCTGGACTCCCTACAGCAAAGGGAGAGTTGAGATTCAAGTCCCACCCGGCTCTTTTGGATGAACCGCTGAGAGCCTCAGGACTGTTTTTGGGGGGCTGA

CTTGTCTTTCTACGTACGTACTTCCAGGCTGCAAGGTTTTGAAATTTTCTGTACAGTTTGTGAGGACATTTGCACTTTGCCACTCAATGTCGTACCTCGG

TTCACTGTTTGTTTTTGAATGCCCTGTTTTCATAGAATCCTATCCTCTCAGATGGTGGAATCTTTGGGGAAACTTTAAAGTAACTAATTTTTATTTAAAA

AAAAAATCTCGGCAGACATAAGAGAACACAACCCCCCATGCACATCTGTAAATGACTGTATGGTTATGATTATAGTACCACGAAAAATCATGTTATTTTT

TTTTAAGACACACACAAAAAGATACTTAAAGACCAAAAACTGTGCTGGGAAGATATGCCCCACCTATCTTTGGTACATGGTAGGTGTTGTGATGGAAATG

GAAAGCATTGGTTAAATGGAATAGAGGTCTTGATCTTTGGAATGCATGCCGGTAATGTATTTTACAGTACATGTTAATAATTTATGTTTAATATTTGTAT

TTGTGTTCTCTTTTGTTATTTTACTTAGGGTATATGGATATTTTGCAATAATTTTAATGATTCTTAAGCTATTTGAAGGAAAGAATATGGATTTCTCATG

TCTTGAGGTTTTGTTCATGCCCCTATGACTGACCAATGTGATAAGGACTTTAAAAAAGAAGCATGTATGTTTTTTACTGTTTGTAAGAAGTACTTTCGTT

AATCTTGCTGCTTATGTGTCAATTTAGTGGAAAAGAAATCCCTTGCTGAAAAAAAAAATCCCTTTCCATTCTCTTCCAGTTCTGTGGTATTGTCCAAGAA

TGTATCAATAAAATACTTTGGTTAACTTTTTTA
Translation
MVQLGKLLRVLTLMKFPCCVLEVLLCVLAAAARGQEMYAPHSIRIEGDVTLGGLFPVHAKGPSGVPCGDIKRENGIHRLEAMLYALDQINSDPNLLPNVT

LGARILDTCSRDTYALEQSLTFVQALIQKDTSDVRCTNGEPPVFVKPEKVVGVIGASGSSVSIMVANILRLFQ IPQISYASTAPELSDDRRYDFFSRVV

PPDSFQAQAMVDIVKALGWNYVSTLASEGSYGEKGVESFTQISKEAG GGLCIAQSVRIPQERKDRTIDFDRIIKQLLDTPNSRAVVIFANDEDIK KQI

LAAAKRADQVGHFLWVGSDSWGSKINPLHQHEDIAEGAITIQPKRATVEG GFDAYFTSRTLENNRRNVWFAEYWEENFNCKLTISGSKKEDTDRKCTG 

GQERIGKDSNYEQEGKVQFVIDAVYAMAHALHHMNKDLCADYRGVCPEMEQAGGKKLLKYIRNVNFNG GSAGTPVMFNKNGDAPGRYDIFQYQTTNTTN

PGYRLIGQWTDELQLN IEDMQWGKGVREIPPSVCTLPCKPGQRKKTQKGTPCCWTCEPCDGYQYQFDEMTCQHCPYDQRPNENRTGCQNIPIIKLEWHS

PWAVIPVFLAMLGIIATIFVMATFIRYNDTPIVRASGRELSYVLLTGIFLCYIITFLMIAKPDVAVCSFRRVFLGLGMCISYAALLTKTNRIYRIFEQGK

KSVTAPRLISPTSQLAITSSLISVQLLGVFIWFGVDPPNIIIDYDEHKTMNPEQARGVLKCDITDLQIICSLGYSILLMVTCTVYAIKTRGVPENFNEAK

PIGFTMYTTCIVWLAFIPIFFGTAQSAEK - UNI33629 - LYIQTTTLTISMNLSASVALGMLYMPKVYIIIFHPELNVQKRKRSFKAVVTAATMSS

RLSHKPSDRPNGEAKTELCENVDPNS SPAAKKKYVSYNNLVI

For any suggestions or comments, please send an email to unitrap@crg.es