Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000056880 (Gadl1)
Chromosomal location
Chr 9: 115818573 - 115983465 (+)
Description
glutamate decarboxylase-like 1 Gene [Source:MGI (curated);Acc:Gadl1-002]
Human Ortholog
not available
Omim not available
UniTrap UNI35645
Vector Insertion
Chr 9: 115950335 - 115983057
Public Clones IST14318E7 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000084841
Sequence
GGACTCTTGTGCAGGAAGGAACCTTGTTCAATTTCATCCGCTGCCTCTTGCTGTTCCAAG GAGACAGTGGCCAGAAGGAGATGACCCCTGGTAAGAAGA

TCCCCATCTTTGTGGATGGGGTTGTACTTAATGGACCTCAAACAGATGTGAAAGCTGGAGAAAAATTTGTTGAAGAAGCCTGTAGGCTCATAATGGAAGA

GGTGGTTTTGAAAGCTACGGACGTCAATGAAAAG GTATGTGAGTGGCAGCCCCCTGAGCAGCTGAGGCAGCTCCTTGACCTGGAGATGAGGGACACAGG

CGAGTCACAGGACAAGCTGCTGAAACTCTGCCAAGACGTCATCCACTTCAGCGTCAAAACCA ACCATCCAAGATTTTTCAACCAGCTCTATGCTGGCCT

TGATTACTACTCCTTGGCGGCCCGGATTATAACAGAGGCGCTGAATCCAAGCAT TTATACGTATGAGGTGTCCCCAGTGTTTCTGTTAGTGGAAGAGGC

GGTTCTGAAGAAAATGATTGAATGTGTTGGCTGGAAAGAAGGGGATGGAATATTTAACCCAG GTGGCTCAGTGTCCAATATGTGTGCAATGAATTTAGC

TAGATACAGACATTGCCCTGATATCAAAGAGAAAGGCCTGTCTGGTTTGCCAAGATTAATCCTTTTCACATCGGCAGAG TGCCATTACTCCATGAAGAA

AGCGGCCTCCTTCCTTGGGATTGGCACTCAGAACGTGTACTTTGTAGAAACAGATGGAAG AGGAAAAATGATACCGGAGGATCTGGAAAAACAAATTTG

GCAAGCGAGACAAGAG GGGGCGGTGCCATTTCTTGTCTGCGCCACCTCTGGTACCACCGTGCTGGGCGCATTTGACCCCCTGGATGAGATTGCTGAGGT

CTGCGAGAGGCATGGCCTCTGGCTCCATGTGGAT GCCTCTTGGGGCGGCTCAGCTTTGGTGTCAAGAAAGCACCGCCGGCTCCTGCATGGCATCCACAG

 GGCTGACTCAGTGGCCTGGAACCCACACAAGATGCTGATGGCGGGAATCCAGTGCTCTGCTCTACTTGTCAAGGACAAATCT GATCTTCTTAAGAAGT

GCTACTCTGCCAAAGCAACGTACCTGTTCCAGCAGGATAAATTCTATGATGTCAGCTATGACACCGGAGACAAGTCCATTCAGTGCAGCAGGAGGCCTGA

TGCATTCAAGTTCTGGATGACCTGGAAGGCTCTGGGCACATCAGGACTCGAGGAGAGAGTAAATCGTGCCTTTGCTCTATCTCG GTACCTGGTAGACGA

AATCAAGAAAAGAGAAGGCTTCAAGCTGCTGATGGAG CCTGAATATACCAATGTTTGCTTTTGGTACATTCCACCGAGTCTCAGAGAGATGGAGGAAGG

ACCAGAGTTCTGGAGAAAGCTTAGCTTG AGGACAGTCCAGTTTATCTGCCGAGGATTCCTTTTGGAAAGGAATGCTGACTCACATTTTGCATTAAGAAA

CTGGAAAACCTTCCCGTCGGTCCTGGCGTAGCGCCGCCCGTGTCCCGGGTAGATCTTGTACCCGCTGAAACTGCACAGCTCGACCTTCATGGTGATAGAT

GTCGGCCTGCCGGGGTAAAGATGGCGAAGAGAAAGAAAGAATCATGGGAGAACCTTCACCCCCAGTCTTAAAATCCTAGAATTTTCATATCTATTTTTAT

TTTGAAACAAAACAAAACAACAACAAAATTATTTCTCCCATG
Translation
TLVQEGTLFNFIRCLLLFQG GDSGQKEMTPGKKIPIFVDGVVLNGPQTDVKAGEKFVEEACRLIMEEVVLKATDVNEK VCEWQPPEQLRQLLDLEMRD

TGESQDKLLKLCQDVIHFSVKTN NHPRFFNQLYAGLDYYSLAARIITEALNPSI IYTYEVSPVFLLVEEAVLKKMIECVGWKEGDGIFNPG GGSVSN

MCAMNLARYRHCPDIKEKGLSGLPRLILFTSAE CHYSMKKAASFLGIGTQNVYFVETDGR RGKMIPEDLEKQIWQARQE GAVPFLVCATSGTTVLGA

FDPLDEIAEVCERHGLWLHVD ASWGGSALVSRKHRRLLHGIHR RADSVAWNPHKMLMAGIQCSALLVKDKS DLLKKCYSAKATYLFQQDKFYDVSYD

TGDKSIQCSRRPDAFKFWMTWKALGTSGLEERVNRAFALSR RYLVDEIKKREGFKLLME PEYTNVCFWYIPPSLREMEEGPEFWRKLSL RTVQFICR

GFLLERNADSHFALRNWKTFPSVLA
Transcript ENSMUST00000121770
Sequence
GAGACAGTGGCCAGAAGGAGATGACCCCTGGTAAGAAGATCCCCATCTTTGTGGATGGGGTTGTACTTAATGGACCTCAAACAGATGTGAAAGCTGGAGA

AAAATTTGTTGAAGAAGCCTGTAGGCTCATAATGGAAGAGGTGGTTTTGAAAGCTACGGACGTCAATGAAAAG GTATGTGAGTGGCAGCCCCCTGAGCA

GCTGAGGCAGCTCCTTGACCTGGAGATGAGGGACACAGGCGAGTCACAGGACAAGCTGCTGAAACTCTGCCAAGACGTCATCCACTTCAGCGTCAAAACC

A ACCATCCAAGATTTTTCAACCAGCTCTATGCTGGCCTTGATTACTACTCCTTGGCGGCCCGGATTATAACAGAGGCGCTGAATCCAAGCAT TTATAC

GTATGAGGTGTCCCCAGTGTTTCTGTTAGTGGAAGAGGCGGTTCTGAAGAAAATGATTGAATGTGTTGGCTGGAAAGAAGGGGATGGAATATTTAACCCA

G GTGGCTCAGTGTCCAATATGTGTGCAATGAATTTAGCTAGATACAGACATTGCCCTGATATCAAAGAGAAAGGCCTGTCTGGTTTGCCAAGATTAATC

CTTTTCACATCGGCAGAG TGCCATTACTCCATGAAGAAAGCGGCCTCCTTCCTTGGGATTGGCACTCAGAACGTGTACTTTGTAGAAACAGATGGAAG 

AGGAAAAATGATACCGGAGGATCTGGAAAAACAAATTTGGCAAGCGAGACAAGAG GGGGCGGTGCCATTTCTTGTCTGCGCCACCTCTGGTACCACCGT

GCTGGGCGCATTTGACCCCCTGGATGAGATTGCTGAGGTCTGCGAGAGGCATGGCCTCTGGCTCCATGTGGAT GCCTCTTGGGGCGGCTCAGCTTTGGT

GTCAAGAAAGCACCGCCGGCTCCTGCATGGCATCCACAG GGCTGACTCAGTGGCCTGGAACCCACACAAGATGCTGATGGCGGGAATCCAGTGCTCTGC

TCTACTTGTCAAGGACAAATCT GATCTTCTTAAGAAGTGCTACTCTGCCAAAGCAACGTACCTGTTCCAGCAGGATAAATTCTATGATGTCAGCTATGA

CACCGGAGACAAGTCCATTCAGTGCAGCAGGAGGCCTGATGCATTCAAGTTCTGGATGACCTGGAAGGCTCTGGGCACATCAGGACTCGAGGAGAGAGTA

AATCGTGCCTTTGCTCTATCTCG GTACCTGGTAGACGAAATCAAGAAAAGAGAAGGCTTCAAGCTGCTGATGGAG CCTGAATATACCAATGTTTGCTT

TTGGTACATTCCACCGAGTCTCAGAGAGATGGAGGAAGGACCAGAGTTCTGGAGAAAGCTTAGCTTG - UNI35645 - GTGGCCCCAGCCATCAAGG

AGAAAATGATGAAGAAGGGAAGTCTGATGTTGGGCTACCAGCCCCACCGGGGGAAGGTCAACTTCTTCCGCCAGGTGGTCATCAGCCCTCAAGTGAGCCG

GGAAGACATGGACTTCCTGCTGGATGAGATAGACAGCCTGGGGAGAGATATGTAGCCATGGCTTTCTTACCCCCAATGGCACCACTCCTGTCCTGGGGAG

GGTCACAGATCCAGTGCGTCTGAAGACACACTAGGTAGATGACAATCCTGGTTCGATTAGGAAACATGTCCACTCCCCCCCTCCCCCGAAAACCAAAATG

CTAAGCAAATAGTCCTAAGGGCTCTTTGGCTGCCTGCTGCTGCTGTTTGTATCATGGAGAAAGTAGATGTAATAAAAAATTATTCCCTC
Translation
MTPGKKIPIFVDGVVLNGPQTDVKAGEKFVEEACRLIMEEVVLKATDVNEK VCEWQPPEQLRQLLDLEMRDTGESQDKLLKLCQDVIHFSVKTN NHPR

FFNQLYAGLDYYSLAARIITEALNPSI IYTYEVSPVFLLVEEAVLKKMIECVGWKEGDGIFNPG GGSVSNMCAMNLARYRHCPDIKEKGLSGLPRLIL

FTSAE CHYSMKKAASFLGIGTQNVYFVETDGR RGKMIPEDLEKQIWQARQE GAVPFLVCATSGTTVLGAFDPLDEIAEVCERHGLWLHVD ASWGGS

ALVSRKHRRLLHGIHR RADSVAWNPHKMLMAGIQCSALLVKDKS DLLKKCYSAKATYLFQQDKFYDVSYDTGDKSIQCSRRPDAFKFWMTWKALGTSG

LEERVNRAFALSR RYLVDEIKKREGFKLLME PEYTNVCFWYIPPSLREMEEGPEFWRKLSL - UNI35645 - VAPAIKEKMMKKGSLMLGYQPHR

GKVNFFRQVVISPQVSREDMDFLLDEIDSLGRDM
Transcript ENSMUST00000119291
Sequence
GGACTCTTGTGCAGGAAGGAACCTTGTTCAATTTCATCCGCTGCCTCTTGCTGTTCCAAG GAGACAGTGGCCAGAAGGAGATGACCCCTGGTAAGAAGA

TCCCCATCTTTGTGGATGGGGTTGTACTTAATGGACCTCAAACAGATGTGAAAGCTGGAGAAAAATTTGTTGAAGAAGCCTGTAGGCTCATAATGGAAGA

GGTGGTTTTGAAAGCTACGGACGTCAATGAAAAG GTATGTGAGTGGCAGCCCCCTGAGCAGCTGAGGCAGCTCCTTGACCTGGAGATGAGGGACACAGG

CGAGTCACAGGACAAGCTGCTGAAACTCTGCCAAGACGTCATCCACTTCAGCGTCAAAACCA ACCATCCAAGATTTTTCAACCAGCTCTATGCTGGCCT

TGATTACTACTCCTTGGCGGCCCGGATTATAACAGAGGCGCTGAATCCAAGCAT TTATACGTATGAGGTGTCCCCAGTGTTTCTGTTAGTGGAAGAGGC

GGTTCTGAAGAAAATGATTGAATGTGTTGGCTGGAAAGAAGGGGATGGAATATTTAACCCAG GTGGCTCAGTGTCCAATATGTGTGCAATGAATTTAGC

TAGATACAGACATTGCCCTGATATCAAAGAGAAAGGCCTGTCTGGTTTGCCAAGATTAATCCTTTTCACATCGGCAGAG TGCCATTACTCCATGAAGAA

AGCGGCCTCCTTCCTTGGGATTGGCACTCAGAACGTGTACTTTGTAGAAACAGATGGAAG AGGAAAAATGATACCGGAGGATCTGGAAAAACAAATTTG

GCAAGCGAGACAAGAG GGGGCGGTGCCATTTCTTGTCTGCGCCACCTCTGGTACCACCGTGCTGGGCGCATTTGACCCCCTGGATGAGATTGCTGAGGT

CTGCGAGAGGCATGGCCTCTGGCTCCATGTGGAT GCCTCTTGGGGCGGCTCAGCTTTGGTGTCAAGAAAGCACCGCCGGCTCCTGCATGGCATCCACAG

 GGCTGACTCAGTGGCCTGGAACCCACACAAGATGCTGATGGCGGGAATCCAGTGCTCTGCTCTACTTGTCAAGGACAAATCT GATCTTCTTAAGAAGT

GCTACTCTGCCAAAGCAACGTACCTGTTCCAGCAGGATAAATTCTATGATGTCAGCTATGACACCGGAGACAAGTCCATTCAGTGCAGCAGGAGGCCTGA

TGCATTCAAGTTCTGGATGACCTGGAAGGCTCTGGGCACATCAGGACTCGAGGAGAGAGTAAATCGTGCCTTTGCTCTATCTCG GTACCTGGTAGACGA

AATCAAGAAAAGAGAAGGCTTCAAGCTGCTGATGGAG CCTGAATATACCAATGTTTGCTTTTGGTACATTCCACCGAGTCTCAGAGAGATGGAGGAAGG

ACCAGAGTTCTGGAGAAAGCTTAGCTTG AGGACAGTCCAGTTTATCTGCCGAGGATTCCTTTTGGAAAGGAATGCTGACTCACATTTTGCATTAAGAAA

CTGGAAAACCTTCCCGTCGGTCCTGGCGTAGCGCCGCCCGTGTCCCGGGTAGATCTTGTACCCGCTGAAACTGCACAGCTCGACCTTCATGGTGATAGAT

GTCGGCCTGCCGGGGTAAAGATGGCGAAGAGAAAGAAAGAATCATGGGAGAACCTTCACCCCCAGTCTTAAAATCCTAGAATTTTCATATCTATTTTTAT

TTTGAAACAAAACAAAACAACAACAAAATTATTTCTCCCATGA
Translation
 MTPGKKIPIFVDGVVLNGPQTDVKAGEKFVEEACRLIMEEVVLKATDVNEK VCEWQPPEQLRQLLDLEMRDTGESQDKLLKLCQDVIHFSVKTN NHP

RFFNQLYAGLDYYSLAARIITEALNPSI IYTYEVSPVFLLVEEAVLKKMIECVGWKEGDGIFNPG GGSVSNMCAMNLARYRHCPDIKEKGLSGLPRLI

LFTSAE CHYSMKKAASFLGIGTQNVYFVETDGR RGKMIPEDLEKQIWQARQE GAVPFLVCATSGTTVLGAFDPLDEIAEVCERHGLWLHVD ASWGG

SALVSRKHRRLLHGIHR RADSVAWNPHKMLMAGIQCSALLVKDKS DLLKKCYSAKATYLFQQDKFYDVSYDTGDKSIQCSRRPDAFKFWMTWKALGTS

GLEERVNRAFALSR RYLVDEIKKREGFKLLME PEYTNVCFWYIPPSLREMEEGPEFWRKLSL RTVQFICRGFLLERNADSHFALRNWKTFPSVLA
Transcript ENSMUST00000069651
Sequence
GGACTCTTGTGCAGGAAGGAACCTTGTTCAATTTCATCCGCTGCCTCTTGCTGTTCCAAG GAGACAGTGGCCAGAAGGAGATGACCCCTGGTAAGAAGA

TCCCCATCTTTGTGGATGGGGTTGTACTTAATGGACCTCAAACAGATGTGAAAGCTGGAGAAAAATTTGTTGAAGAAGCCTGTAGGCTCATAATGGAAGA

GGTGGTTTTGAAAGCTACGGACGTCAATGAAAAG GTATGTGAGTGGCAGCCCCCTGAGCAGCTGAGGCAGCTCCTTGACCTGGAGATGAGGGACACAGG

CGAGTCACAGGACAAGCTGCTGAAACTCTGCCAAGACGTCATCCACTTCAGCGTCAAAACCA ACCATCCAAGATTTTTCAACCAGCTCTATGCTGGCCT

TGATTACTACTCCTTGGCGGCCCGGATTATAACAGAGGCGCTGAATCCAAGCAT TTATACGTATGAGGTGTCCCCAGTGTTTCTGTTAGTGGAAGAGGC

GGTTCTGAAGAAAATGATTGAATGTGTTGGCTGGAAAGAAGGGGATGGAATATTTAACCCAG GTGGCTCAGTGTCCAATATGTGTGCAATGAATTTAGC

TAGATACAGACATTGCCCTGATATCAAAGAGAAAGGCCTGTCTGGTTTGCCAAGATTAATCCTTTTCACATCGGCAGAG TGCCATTACTCCATGAAGAA

AGCGGCCTCCTTCCTTGGGATTGGCACTCAGAACGTGTACTTTGTAGAAACAGATGGAAG AGGAAAAATGATACCGGAGGATCTGGAAAAACAAATTTG

GCAAGCGAGACAAGAG GGGGCGGTGCCATTTCTTGTCTGCGCCACCTCTGGTACCACCGTGCTGGGCGCATTTGACCCCCTGGATGAGATTGCTGAGGT

CTGCGAGAGGCATGGCCTCTGGCTCCATGTGGAT GCCTCTTGGGGCGGCTCAGCTTTGGTGTCAAGAAAGCACCGCCGGCTCCTGCATGGCATCCACAG

 GGCTGACTCAGTGGCCTGGAACCCACACAAGATGCTGATGGCGGGAATCCAGTGCTCTGCTCTACTTGTCAAGGACAAATCT GATCTTCTTAAGAAGT

GCTACTCTGCCAAAGCAACGTACCTGTTCCAGCAGGATAAATTCTATGATGTCAGCTATGACACCGGAGACAAGTCCATTCAGTGCAGCAGGAGGCCTGA

TGCATTCAAGTTCTGGATGACCTGGAAGGCTCTGGGCACATCAGGACTCGAGGAGAGAGTAAATCGTGCCTTTGCTCTATCTCG GTACCTGGTAGACGA

AATCAAGAAAAGAGAAGGCTTCAAGCTGCTGATGGAG CCTGAATATACCAATGTTTGCTTTTGGTACATTCCACCGAGTCTCAGAGAGATGGAGGAAGG

ACCAGAGTTCTGGAGAAAGCTTAGCTTG - UNI35645 - GTGGCCCCAGCCATCAAGGAGAAAATGATGAAGAAGGGAAGTCTGATGTTGGGCTACC

AGCCCCACCGGGGGAAGGTCAACTTCTTCCGCCAGGTGGTCATCAGCCCTCAAGTGAGCCGGGAAGACATGGACTTCCTGCTGGATGAGATAGACAGCCT

GGGGAGAGATATGTAG
Translation
       MIPEDLEKQIWQARQE GAVPFLVCATSGTTVLGAFDPLDEIAEVCERHGLWLHVD ASWGGSALVSRKHRRLLHGIHR RADSVAWNPHKML

MAGIQCSALLVKDKS DLLKKCYSAKATYLFQQDKFYDVSYDTGDKSIQCSRRPDAFKFWMTWKALGTSGLEERVNRAFALSR RYLVDEIKKREGFKLL

ME PEYTNVCFWYIPPSLREMEEGPEFWRKLSL - UNI35645 - VAPAIKEKMMKKGSLMLGYQPHRGKVNFFRQVVISPQVSREDMDFLLDEIDSL

GRDM

For any suggestions or comments, please send an email to unitrap@crg.es