Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000056951 (Rbm4)
Chromosomal location
Chr 19: 4784299 - 4793877 (-)
Description
RNA binding motif protein 4 Gene [Source:MGI Symbol;Acc:MGI:1100865]
RefSeq_dna
NM_009032 
RefSeq_peptide
NP_033058.2 
MGI
MGI:1100865 
Uniprot/SWISSPROT
Q8C7Q4 
Uniprot/SPTREMBL
A1L3S3 Q5CZX8 
Human Ortholog
not available
Omim not available
UniTrap UNI19443
Vector Insertion
Chr 19: 4792821 - 4793671
Public Clones not available
Private Clones OST391058 (lexicon) OST234076 (lexicon) OST132262 (lexicon) OST44780 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI100
Vector Insertion
Chr 19: 4788043 - 4792397
Public Clones GC0024 (tigem) HMA536 (baygenomics) CSD015 (baygenomics) XE528 (baygenomics)
CSJ099 (baygenomics) YHC064 (baygenomics) XC349 (baygenomics) CSH554 (baygenomics)
F020A06 (ggtc) IST14841D11 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 38% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI12904
Vector Insertion
Chr 19: 4785568 - 4787360
Public Clones CMHD-GT_339E9-3 (cmhd) PSTVUpb6h3R1 (vanderbilt) PSTVUb3p3h8fs (vanderbilt)
PSTVUpb7e12 (vanderbilt)
Private Clones not available
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000006628
Sequence
ATTTTAGCGTTTTGTCAGAACCGTCCGCGCTGCAAGGAGGAGGACCTGCAGGTATCCATGCGGTGAGATACTCCACGTTCTTCCACTGTGTTCTTTTCTC

TGTTAAAAAAACTTACCTGACTCCGGTGGGTGTCAGGGTTGGCATAGTGGGGTTGCGGTCTGCGCACCCGTCCCTGAGAGCCGACATCGGTCCTCGACTT

AGTGCG - UNI19443 - GCTGTGTGGAGATGGTGAAGCTGTTCATTGGAAATCTGCCCCGGGAGGCCACAGAGCAGGAGATCCGCTCACTCTTCGAG

CAGTACGGGAAGGTGCTGGAATGTGACATCATTAAGAATTATGGCTTTGTGCACATAGAGGACAAGACGGCCGCTGAGGATGCCATACGCAACCTGCACC

ACTACAAGCTGCACGGAGTGAACATCAATGTGGAAGCCAGCAAGAATAAGAGCAAAGCTTCAACCAAGTTACACGTGGGCAACATCAGCCCCACTTGTAC

CAACCAAGAGCTTCGGGCCAAGTTTGAGGAGTACGGCCCAGTCATCGAATGTGACATCGTGAAAGATTATGCCTTTGTACACATGGAGCGGGCAGAGGAT

GCGGTGGAGGCCATCAGGGGCCTCGACAACACAGAGTTTCAAG - UNI100 - GCAAACGAATGCACGTGCAGTTGTCCACCAGCCGGCTTAGGACCG

CGCCCGGGATGGGAGACCAGAGCGGCTGCTATCGGTGCGGGAAAGAGGGGCACTGGTCCAAAGAGTGTCCAATAGATCGTTCGGGCCGCGTGGCAGACTT

GACCGAGCAATATAATGAGCAATATGGAGCAGTGCGTACGCCTTACACCATGAGTTATGGGGATTCATTGTATTACAACAACACGTACGGAGCGCTCGAT

GCCTACTACAAGCGCTGCCGTGCTGCCCGGTCCTATGAGGCAGTGGCAGCTGCAGCTGCCTCTGCGTATAGTAACTATGCAGAGCAGACTTTGTCTCAGC

TGCCACAAGTCCAGAACACAGCCATGGCCAGTCACCTCACCTCCACCTCTCTCGATCCCTACAATAGACATCTGTTGCCGCCTTCAGGAGCTGCAGCAGC

AGCAGCAGCTGCTGCTGCTTGTACTGCAGCTTCTACTTCATATTACGGGCGGGATCGGAGCCCCCTGCGTCGCGCTACAGGCCCAGTCCTCACTGTTGGA

GAGGGCTACGGTTACGGGCATGACAGTGAGTTGTCCCAAGCTTCAGCAGCTGCTCGGAATTCCCTGTACGACATGGCCCGGTATGAGCGGGAGCAGTATG

CGGATCGGGCGCGGTACTCAGCCTTTTAAAGTTTGAG - UNI12904 - GTGGGATGTGTGTGGGCTGAAATCCCAAGCTGCGGTTGTGCATGAGAAT

ACACCCTTCGTGGTGCCCCATCTCCGGGACGTTCTCGGCTCTGTGCATTCAGTCCCCAGGAACCGTGGACCTTAATTTACCTTGTTAAGTTCTTTCTCTT

TCCTATTCTCTCTCCTGCTCAATTTCCTGTTCTCCTGTTTGCTCTTCTGTAGCTTCCCCTTTGAGTTCTGCTCTCCCAGCATGCCTCCTATGCAGAAACC

GGTGGGGCTGTGCTGTCTCCTCCCTTCCTCCTGACTGCAGTCAGTGGGTATTGGATTTGGGAGTGACCTTGTTGAGAATCACTGCTCCTAGTTTTCTATT

TTGGCCCAAAGACTAGACTTAGAAATTTGGAGCACCTTCCAGTGAAATAAATGGTTTTTCAAATTAGGGTATGTGTGCTTTGAGAAAGTTCTTGTTTGGG

CTTGTTTCTGGGTTCTTTATTTATTTGTACCCTGAACAGAAGATGGGGGAGTGTTTAAAGTTTAAGCTACTTAGCTTTTGGCTAACACTGAGGTTTTTAA

ATTTTGCTTTTTAAAATAGTAGATGACTTTAGGTACTAAATTAAAAAAAGAGGTTCTACAGAACTCAAGTAGGCATCTCTGTTTCAATGAAGACATCTCC

TACTGGTCTACTTCTGTTGAAGCCAGTTAGCTAGTGGTTTAGAGCTGTAGATCTTTACTTGCTGGAGAATTAATCATTGTGTATACTTGCATCTGCTGTT

AACACTCAGTAAACATATCTCCCTTGACTTATTTTCAGGAAAAAGGTGAAGGTTTGAGGAAGAAGAGGTAGCTTTCATCTTTGGGAAAAATGAAGGTATG

GCTCCCACAGAGTTATTTAGCTACTCCATAGGCCAGAACTACCTCATGATGCACTTCACTATTTATAGTTCTGCCAAAATCAAGAGACTGCATTCCACAA

GCATCTCATAGCTTGTACTTAATGCCTTCAGATGAGGTATAAAGGGCCCAGCGGGTCCTTTGTAAGTCCTTGATAAACTTACTGAGTCTTTAACAGTGAA

GACAAGTATTTGGATTCAGTGAGGAGCCACTGTTTAGTGTCATGTTTTTATTGAAACAGTTTATTTTCTATGTTTTATTTTAACATATATAGGGCCTCGT

CTCAGAATCATTTATTTGACCACTACTGGATACCTATGTTGTGTCAGGCATGCTTTTAGTAAAGGGCTCATTAATGATAAAAGGAAATATGATAGAGATA

AAAGATGAAATAAAGATGAG
Translation
 - UNI19443 - MVKLFIGNLPREATEQEIRSLFEQYGKVLECDIIKNYGFVHIEDKTAAEDAIRNLHHYKLHGVNINVEASKNKSKASTKLHVGNIS

PTCTNQELRAKFEEYGPVIECDIVKDYAFVHMERAEDAVEAIRGLDNTEFQG - UNI100 - GKRMHVQLSTSRLRTAPGMGDQSGCYRCGKEGHWSK

ECPIDRSGRVADLTEQYNEQYGAVRTPYTMSYGDSLYYNNTYGALDAYYKRCRAARSYEAVAAAAASAYSNYAEQTLSQLPQVQNTAMASHLTSTSLDPY

NRHLLPPSGAAAAAAAAAACTAASTSYYGRDRSPLRRATGPVLTVGEGYGYGHDSELSQASAAARNSLYDMARYEREQYADRARYSAF - UNI12904 

- 

For any suggestions or comments, please send an email to unitrap@crg.es