Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000057093 (C030039L03Rik)
Chromosomal location
Chr 7: 28474359 - 28491503 (+)
Description
RIKEN cDNA C030039L03 gene Gene [Source:MGI Symbol;Acc:MGI:2148237]
RefSeq_dna
NM_198417 
RefSeq_peptide
NP_001106202.1 NP_940809.2 
UniGene
Mm.145362 
MGI
MGI:2148237 
Uniprot/SPTREMBL
Q3URA4 Q3US05 Q6P9L8 
Human Ortholog
not available
Omim not available
UniTrap UNI20942
Vector Insertion
Chr 7: 28474506 - 28476233
Public Clones not available
Private Clones OST347750 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI24590
Vector Insertion
Chr 7: 28477520 - 28477554
Public Clones not available
Private Clones OST214018 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI15755
Vector Insertion
Chr 7: 28477554 - 28478500
Public Clones PST1331-NL (escells)
Private Clones not available
Severity of mutation (?) Insertion after 2% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI30082
Vector Insertion
Chr 7: 28478628 - 28483671
Public Clones D122D03 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 8% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI22324
Vector Insertion
Chr 7: 28483771 - 28487398
Public Clones not available
Private Clones OST300415 (lexicon) OST231887 (lexicon) OST167929 (lexicon)
Severity of mutation (?) Insertion after 14% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000120004
Sequence
TGAAGCATTATATTTCTTGTAGTTTGGGACAAGGGGACTACATTTCCCAGGCAGCATAGGGTCGGAAGTAGATAACTTCTGGTGTGCAGGCGGAGCTACC

CCGGATGGTCAGGTGGGAATCAGAAGTCACTGGTTGGCCTCCACAGA - UNI20942 - GGTTGTGCCCACCAGACCTGTGCGCACCATGCATGTGCC

TTGAGAGGCCTGAAGAGGGCGCCAACTCCCCTGAAGCTGGAG GGGAGGAAGCCTGAAGAAGAATGGCCAGCTCCAGTTCTCAACACATGGTCTGT - U

NI15755 - - UNI24590 - GGGTCAGTGACATTTAGGGATGTGGCTGTTGACTTCTCTCAGGAGGAGTGGGCCTGCCTGGATGCTACTCAGAAGGT

GTTATACAGGAACATAATGTTGGAGACCTACAGCAACCTGGTCGCAGTGG - UNI30082 - TGGGACGTTGTATTTCCAAGCCAGATCTGATCGTCT

TACTAGAGCAGGAGAAAGAGCCCTGGATGGCTGTGAAGGAAGAAACAGACAGGCCGAGCCCAG - UNI22324 - ATGTGGAGACATGTGTTGAAGCT

GAAAATATATCTCCGGAGAATCATATGTCTGATGTAAATTTACACAAACAGAGCATAAGGCAATTCAGTAAAACTTTTGACCTTAAAGAGTCTACTTTTA

GTGATGGCCCCAGCTGTAGTACATTCAAAGGACTACAGGGTTATCAAGGAGATGCTGATGAAAGGGTTACTAAGAAGGAAAGAGTGCCTCCTTGTACCTG

CCAGACTCTTGCTCACAATACAGAAAAGGCATATGAGTGTAAAGAGTGTGGGACGTGCTTCGATTGTAGTTCAGCTCTTACTCAGCATCAGAGTGTTCAT

GCTGGAGAGAAGCTCTATGAATGTAAGGAGTGTGGGAAGGCCTTCAGACTCCCCCAAGAGCTCACAAGGCATCAGAAGTCTCACAGTGGTGAGAAACCTT

TCCAGTGTAATGAATGTGGAAAGGCTTTTCATCTTCCCGACCTGCTGAAATATCATAAAGTCATTCATACAGGTGAAAAGCCTTTTGAATGTGAAGTATG

TGGGAAGTTCTTCAGCCGTGTCTCCAGCCTTGCTGAACATAGGATTGTCCATGCTGATGTGAAACCCTATGAGTGTAGTGAGTGTGGGAAAGCCTTTAAA

CGTCGCTCAGACCTAATGCAACATCAGAAAATCCATTCTGGTGAGAGACCCTTTCAGTGTAAGGACTGTGGGAAGGCCTTCATTGTTCTGGCACAGCTCG

CTCAGCACCAGAGCATTCACACTGGAGAGAAATTGGAATGTAAGCATTGTGGGAAGATATTTAGTAGTGGTTTTTACCTTGTACGACACCAGAGTATTCA

CACTGGTGAGAAACCCTTTGGGTGTCATGTCTGTGGCAAGGCTTTTAGGCTTCAGGTATACCTTAATGAGCATCAGAAAACTCACACCGATGAGAAACCT

TTCAAGTGTAAGCTGTGTGGGTCAGCCTTTAGACGTAAATACCAGCTCAGTGAACATCAGAAAATCCATACCAATGTGAAACCGTATCAGTGCAAAGAAT

GTGGGAAATCCTTTCGTCGACGATCAAATTTTACTGAGCATCAGAGTATTCACACTGGAAAGAAACCCTTTGAATGTAAGGACTGTGGGAAGGTCTTTAG

ACTAAATATACATCTCATTCGACACCAGAGATTTCATAGTGGTAAGACACCTTTTGAATGTAATGAATGTGGAAAGGGCTTTCATTTTTCCAGCCAGCTT

AATTACCATAAAACCATTCATACAGGTCAGACACCTTTTGAATGTAAAGAATGTGGGAAGTCTTTCAAGCGCATCTGCAGCCTTTTGGAACATGGGGTTA

TTCATGCTGCTGTGAAACCATTTGAATGTAGTGAGTGTGGGAAAACCTTTAATCGTCGCTCAAACCTCATACAACATCAGAAAATTCATTCTGATGAGAG

ACCCTTTGAGTGTAAGGACTGTGGGAAGGCCTTCACTGTTCTGGCTCAGCTCACACGACACCACACTATTCATACTGGAAAGAAATCATATGAATGTGAG

CAGTGTGGGTCAGCCTTCAGACTCCCGTACCAACTCACTCAACATCAGAGAATTCATGATGATGTGAAACCATTTCAGTGCAAGGAATGTGGAAAGGGCT

TTGTTCGTGGTACAGCTCTTAGAATCCACCAAAGAGTCCATACTGGTGAGGCCCTTCCAGTGTGAAAAATGTGGAGAAGGTTTTTCCAATATCATTACCA

ATTTCTTGGACATTTTAGAATTCATACTGGCAAGAAGCCTTATGAATGTAAAGAATGTGGGAAGGACTTTGCTCGTGGTGGAGACCTTAACGTACATCAA

AGAATTCACACTGGTGGGAAACCATACCAGTGTTAAAAGTTCAAAATCAAGCTTGGTTTGAAATGCTAAAATTCATATTAATAAGAAACCACCTGGAAAG

TCCTGGAGTAATTCTAAGATAGCTGAATTCATACTGGTAAGAAAATGTTAATCCGTCTGGTGGAGAATAAGACCACACCACTGCCGGGTGTGGTGACACA

CACCTTTAATCCCAGCACTTGGGAGGCAGAGGCAGGCGGATTTCTGAGTTCGAGGCCAGCCTGGTCTACAAAGTGAGTTCCAGGACAGCCAGGGCTACAC

AGAGAGACCCTGTCTTGAAAAACAAAAAACAAAACAACAACAATAAAAAAGACCACACCACAGTTTAAAGCCAAGTTTGAAGTAGGCTTTAAGTAAATAC

TGGCCAGGTGATGGACTCCCTGGCCAGGTCCAGCTTTGGGTTTCCAGAAAAAACCATGAGTCCCACCTTGCAGGGGCTTAGATAGGCACCCCCACAAGGC

CGCTGTATTTTCCACCAGGTACAAGCAGGGGTAAGCATATAATCTGACTTGTTTCCTACTTAGGTACCTCCTGCCTACATATCAAATGGGGGGCTGGGTA

CTTCCTAATATATTTCCTTCTCATGGGCTTCCTCTCCAACCTGTGATGAAGAACATCTGGTATAGTTGGGGCAAACAAACTTGTTAAGGGGAATGAAAGT

GTGGCTTGTTATTGCCCATAAACAATAGCCTGCAGTATTTCAGGAACTATTTGACCTTGGGTAAGGGGCTTACAGGCTAGCAGCATTTTTGTTTCCTAGG

TCTTAGGCACAGTAATTAAAACTTGGAACGTAACTTTGGCTCTTACAAAGCTCTGTGAAGGTAGGAAATGCGGATAATGTTTAGATTTAGTTCAGCCTTT

ACTACACACTGGAGAATTCATACTGGTGTGAAACCCTTATCACTGTAAATAACATGGAAAGACCTCTAATTAGCCCTCAAGCCTTCTTCAAAATAAAATA

ATCCATGCTGGTGTCAAACATGACTGCAAAGGAATGTGGGAACAGAGACCCCATGGATGTCAAGACTGTGGGAAAGCCTTTATTGTAAATTGTGAGCTTA

TACAAAATCAGAAAATCCATGTTCAGAAGTCCTGTGCATGTAAGGGAAGTGGACAAGCTTTTGTCTGGAAATTTTACTGATCATCAGAGAACTCATATTG

GTAAGATTGTGACTTAAAAGAATGTAGGAAGGACTTTAATTTGCTCTAGGATTTGGTCAATATCTGAATATTCATATGCTCTTCGTGCCAAGAAACCCTT

TGAGAATGAGTGTGCCGAAAGTCTGTGTTTAGAGAAGATTCTCTGGTGAGAATGTTCTTGACTTACTCTCCTCTTGTTAATTCTACACCCTTAACGAAAC

ATTACTCAGTCAATTTAGAAAGAGCAGTTATTGGAAGTAGGATTATTTATGGTATCTTTTTTGTCACCATTAACACTAAGGGGCTCCTGTGATATTAGAC

TGGATGTTTCTTTCGGCATAATTTGTTAATGGTGAGCATGGTACCAGGCAGACGTGTGGAAACAGGGTTATAATGGATAGAGAATACTTAAGAGTATTTG

GTATGTTCTGTGAAGTAGCTTCTACAGTGTTGGTGCTCTCACGGGCGTTACTGTAATGGAAATGAAAGACAAGCTGTGTCGCAGATTTTTTAGAAAAGCC

TCATGCAGTCCTCCAGTGTTAAATTCCAAATACTTCCCTATGGGTAAAATCTAATAGATGAACAGGTACACACACACACAAAATCTTCATTCCCAATCCA

TTCCTTAAGCTTTTGTGCAGAGATGTCAAAAACACAGCTGTTGGTGAATAAGTACTCTTTAAAGGAGTTAAACACATGTAACTTTCAAAAGCTAAAATCA

TGTAATTTATGCTCTCTGCCCAGACATTAAGATAAAAGACATTTGTGACAGGGAAAGACAGTGCAGTCTCCTCCATCTCATATTTTTGTGGAAAGTTACC

CAATTCTATGAACCAGAGGTAAAGCTGCCCTTGCTAATTTATCATGGCTTCTGTCAAACTGCCACCATGCTCAAATCTCTCCTTTCAGCTAGCCTCTTGT

CTTGGCTTCTGTTAAACTGCCTGCTTGTGCAAAAGCTTCCCCTGCAGCTGTTGAACAAAATAACAGAATGTAGTCTTTGCTTTTAATAGCCCCTTACTCT

AAACACTTGGAGCTATAATTAGATCGTATATACCTGAGTGTAGTTCCAGACAACTGGAATAAAGTCTTTCAGTTGGCTAAAA
Translation
 - UNI20942 -  MASSSSQHMVC - UNI15755 - - UNI24590 - GSVTFRDVAVDFSQEEWACLDATQKVLYRNIMLETYSNLVAVV - U

NI30082 - VGRCISKPDLIVLLEQEKEPWMAVKEETDRPSPD - UNI22324 - DVETCVEAENISPENHMSDVNLHKQSIRQFSKTFDLKESTFS

DGPSCSTFKGLQGYQGDADERVTKKERVPPCTCQTLAHNTEKAYECKECGTCFDCSSALTQHQSVHAGEKLYECKECGKAFRLPQELTRHQKSHSGEKPF

QCNECGKAFHLPDLLKYHKVIHTGEKPFECEVCGKFFSRVSSLAEHRIVHADVKPYECSECGKAFKRRSDLMQHQKIHSGERPFQCKDCGKAFIVLAQLA

QHQSIHTGEKLECKHCGKIFSSGFYLVRHQSIHTGEKPFGCHVCGKAFRLQVYLNEHQKTHTDEKPFKCKLCGSAFRRKYQLSEHQKIHTNVKPYQCKEC

GKSFRRRSNFTEHQSIHTGKKPFECKDCGKVFRLNIHLIRHQRFHSGKTPFECNECGKGFHFSSQLNYHKTIHTGQTPFECKECGKSFKRICSLLEHGVI

HAAVKPFECSECGKTFNRRSNLIQHQKIHSDERPFECKDCGKAFTVLAQLTRHHTIHTGKKSYECEQCGSAFRLPYQLTQHQRIHDDVKPFQCKECGKGF

VRGTALRIHQRVHTGEALPV
Transcript ENSMUST00000076421
Sequence
ATGGCCAGCTCCAGTTCTCAACACATGGTCTGT - UNI15755 - - UNI24590 - GGGTCAGTGACATTTAGGGATGTGGCTGTTGACTTCTCTC

AGGAGGAGTGGGCCTGCCTGGATGCTACTCAGAAGGTGTTATACAGGAACATAATGTTGGAGACCTACAGCAACCTGGTCGCAGTGG - UNI30082 -

 TGGGACGTTGTATTTCCAAGCCAGATCTGATCGTCTTACTAGAGCAGGAGAAAGAGCCCTGGATGGCTGTGAAGGAAGAAACAGACAGGCCGAGCCCAG

 - UNI22324 - ATGTGGAGACATGTGTTGAAGCTGAAAATATATCTCCGGAGAATCATATGTCTGATGTAAATTTACACAAACAGAGCATAAGGCAA

TTCAGTAAAACTTTTGACCTTAAAGAGTCTACTTTTAGTGATGGCCCCAGCTGTAGTACATTCAAAGGACTACAGGGTTATCAAGGAGATGCTGATGAAA

GGGTTACTAAGAAGGAAAGAGTGCCTCCTTGTACCTGCCAGACTCTTGCTCACAATACAGAAAAGGCATATGAGTGTAAAGAGTGTGGGACGTGCTTCGA

TTGTAGTTCAGCTCTTACTCAGCATCAGAGTGTTCATGCTGGAGAGAAGCTCTATGAATGTAAGGAGTGTGGGAAGGCCTTCAGACTCCCCCAAGAGCTC

ACAAGGCATCAGAAGTCTCACAGTGGTGAGAAACCTTTCCAGTGTAATGAATGTGGAAAGGCTTTTCATCTTCCCGACCTGCTGAAATATCATAAAGTCA

TTCATACAGGTGAAAAGCCTTTTGAATGTGAAGTATGTGGGAAGTTCTTCAGCCGTGTCTCCAGCCTTGCTGAACATAGGATTGTCCATGCTGATGTGAA

ACCCTATGAGTGTAGTGAGTGTGGGAAAGCCTTTAAACGTCGCTCAGACCTAATGCAACATCAGAAAATCCATTCTGGTGAGAGACCCTTTCAGTGTAAG

GACTGTGGGAAGGCCTTCATTGTTCTGGCACAGCTCGCTCAGCACCAGAGCATTCACACTGGAGAGAAATTGGAATGTAAGCATTGTGGGAAGATATTTA

GTAGTGGTTTTTACCTTGTACGACACCAGAGTATTCACACTGGTGAGAAACCCTTTGGGTGTCATGTCTGTGGCAAGGCTTTTAGGCTTCAGGTATACCT

TAATGAGCATCAGAAAACTCACACCGATGAGAAACCTTTCAAGTGTAAGCTGTGTGGGTCAGCCTTTAGACGTAAATACCAGCTCAGTGAACATCAGAAA

ATCCATACCAATGTGAAACCGTATCAGTGCAAAGAATGTGGGAAATCCTTTCGTCGACGATCAAATTTTACTGAGCATCAGAGTATTCACACTGGAAAGA

AACCCTTTGAATGTAAGGACTGTGGGAAGGTCTTTAGACTAAATATACATCTCATTCGACACCAGAGATTTCATAGTGGTAAGACACCTTTTGAATGTAA

TGAATGTGGAAAGGGCTTTCATTTTTCCAGCCAGCTTAATTACCATAAAACCATTCATACAGGTCAGACACCTTTTGAATGTAAAGAATGTGGGAAGTCT

TTCAAGCGCATCTGCAGCCTTTTGGAACATGGGGTTATTCATGCTGCTGTGAAACCATTTGAATGTAGTGAGTGTGGGAAAACCTTTAATCGTCGCTCAA

ACCTCATACAACATCAGAAAATTCATTCTGATGAGAGACCCTTTGAGTGTAAGGACTGTGGGAAGGCCTTCACTGTTCTGGCTCAGCTCACACGACACCA

CACTATTCATACTGGAAAGAAATCATATGAATGTGAGCAGTGTGGGTCAGCCTTCAGACTCCCGTACCAACTCACTCAACATCAGAGAATTCATGATGAT

GTGAAACCATTTCAGTGCAAGGAATGTGGAAAGGGCTTTGTTCGTGGTACAGCTCTTAGAATCCACCAAAGAGTCCATACTGGTGAGGCCCTTCCAGTGT

GAAAAATGTGGAGAAGGTTTTTCCAATATCATTACCAATTTCTTGGACATTTTAGAATTCATACTGGCAAGAAGCCTTATGAATGTAAAGAATGTGGGAA

GGACTTTGCTCGTGGTGGAGACCTTAACGTACATCAAAGAATTCACACTGGTGGGAAACCATACCAGTGTTAAAAGTTCAAAATCAAGCTTGGTTTGAAA

TGCTAAAATTCATATTAATAAGAAACCACCTGGAAAGTCCTGGAGTAATTCTAAGATAGCTGAATTCATACTGGTAAGAAAATGTTAATCCGTCTGGTGG

AGAATAAGACCACACCACTGCCGGGTGTGGTGACACACACCTTTAATCCCAGCACTTGGGAGGCAGAGGCAGGCGGATTTCTGAGTTCGAGGCCAGCCTG

GTCTACAAAGTGAGTTCCAGGACAGCCAGGGCTACACAGAGAGACCCTGTCTTGAAAAACAAAAAACAAAACAACAACAATAAAAAAGACCACACCACAG

TTTAAAGCCAAGTTTGAAGTAGGCTTTAAGTAAATACTGGCCAGGTGATGGACTCCCTGGCCAGGTCCAGCTTTGGGTTTCCAGAAAAAACCATGAGTCC

CACCTTGCAGGGGCTTAGATAGGCACCCCCACAAGGCCGCTGTATTTTCCACCAGGTACAAGCAGGGGTAAGCATATAATCTGACTTGTTTCCTACTTAG

GTACCTCCTGCCTACATATCAAATGGGGGGCTGGGTACTTCCTAATATATTTCCTTCTCATGGGCTTCCTCTCCAACCTGTGATGAAGAACATCTGGTAT

AGTTGGGGCAAACAAACTTGTTAAGGGGAATGAAAGTGTGGCTTGTTATTGCCCATAAACAATAGCCTGCAGTATTTCAGGAACTATTTGACCTTGGGTA

AGGGGCTTACAGGCTAGCAGCATTTTTGTTTCCTAGGTCTTAGGCACAGTAATTAAAACTTGGAACGTAACTTTGGCTCTTACAAAGCTCTGTGAAGGTA

GGAAATGCGGATAATGTTTAGATTTAGTTCAGCCTTTACTACACACTGGAGAATTCATACTGGTGTGAAACCCTTATCACTGTAAATAACATGGAAAGAC

CTCTAATTAGCCCTCAAGCCTTCTTCAAAATAAAATAATCCATGCTGGTGTCAAACATGACTGCAAAGGAATGTGGGAACAGAGACCCCATGGATGTCAA

GACTGTGGGAAAGCCTTTATTGTAAATTGTGAGCTTATACAAAATCAGAAAATCCATGTTCAGAAGTCCTGTGCATGTAAGGGAAGTGGACAAGCTTTTG

TCTGGAAATTTTACTGATCATCAGAGAACTCATATTGGTAAGATTGTGACTTAAAAGAATGTAGGAAGGACTTTAATTTGCTCTAGGATTTGGTCAATAT

CTGAATATTCATATGCTCTTCGTGCCAAGAAACCCTTTGAGAATGAGTGTGCCGAAAGTCTGTGTTTAGAGAAGATTCTCTGGTGAGAATGTTCTTGACT

TACTCTCCTCTTGTTAATTCTACACCCTTAACGAAACATTACTCAGTCAATTTAGAAAGAGCAGTTATTGGAAGTAGGATTATTTATGGTATCTTTTTTG

TCACCATTAACACTAAGGGGCTCCTGTGATATTAGACTGGATGTTTCTTTCGGCATAATTTGTTAATGGTGAGCATGGTACCAGGCAGACGTGTGGAAAC

AGGGTTATAATGGATAGAGAATACTTAAGAGTATTTGGTATGTTCTGTGAAGTAGCTTCTACAGTGTTGGTGCTCTCACGGGCGTTACTGTAATGGAAAT

GAAAGACAAGCTGTGTCGCAGATTTTTTAGAAAAGCCTCATGCAGTCCTCCAGTGTTAAATTCCAAATACTTCCCTATGGGTAAAATCTAATAGATGAAC

AGGTACACACACACACAAAATCTTCATTCCCAATCCATTCCTTAAGCTTTTGTGCAGAGATGTCAAAAACACAGCTGTTGGTGAATAAGTACTCTTTAAA

GGAGTTAAACACATGTAACTTTCAAAAGCTAAAATCATGTAATTTATGCTCTCTGCCCAGACATTAAGATAAAAGACATTTGTGACAGGGAAAGACAGTG

CAGTCTCCTCCATCTCATATTTTTGTGGAAAGTTACCCAATTCTATGAACCAGAGGTAAAGCTGCCCTTGCTAATTTATCATGGCTTCTGTCAAACTGCC

ACCATGCTCAAATCTCTCCTTTCAGCTAGCCTCTTGTCTTGGCTTCTGTTAAACTGCCTGCTTGTGCAAAAGCTTCCCCTGCAGCTGTTGAACAAAATAA

CAGAATGTAGTCTTTGCTTTTAATAGCCCCTTACTCTAAACACTTGGAGCTATAATTAGATCGTATATACCTGAGTGTAGTTCCAGACAACTGGAATAAA

GTCTTTCAGTTGGCT
Translation
MASSSSQHMVC - UNI15755 - - UNI24590 - GSVTFRDVAVDFSQEEWACLDATQKVLYRNIMLETYSNLVAVV - UNI30082 - VGRCI

SKPDLIVLLEQEKEPWMAVKEETDRPSPD - UNI22324 - DVETCVEAENISPENHMSDVNLHKQSIRQFSKTFDLKESTFSDGPSCSTFKGLQGYQ

GDADERVTKKERVPPCTCQTLAHNTEKAYECKECGTCFDCSSALTQHQSVHAGEKLYECKECGKAFRLPQELTRHQKSHSGEKPFQCNECGKAFHLPDLL

KYHKVIHTGEKPFECEVCGKFFSRVSSLAEHRIVHADVKPYECSECGKAFKRRSDLMQHQKIHSGERPFQCKDCGKAFIVLAQLAQHQSIHTGEKLECKH

CGKIFSSGFYLVRHQSIHTGEKPFGCHVCGKAFRLQVYLNEHQKTHTDEKPFKCKLCGSAFRRKYQLSEHQKIHTNVKPYQCKECGKSFRRRSNFTEHQS

IHTGKKPFECKDCGKVFRLNIHLIRHQRFHSGKTPFECNECGKGFHFSSQLNYHKTIHTGQTPFECKECGKSFKRICSLLEHGVIHAAVKPFECSECGKT

FNRRSNLIQHQKIHSDERPFECKDCGKAFTVLAQLTRHHTIHTGKKSYECEQCGSAFRLPYQLTQHQRIHDDVKPFQCKECGKGFVRGTALRIHQRVHTG

EALPV

For any suggestions or comments, please send an email to unitrap@crg.es