Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000057110 (Cep110)
Chromosomal location
Chr 2: 34965012 - 35034342 (+)
Description
centrosomal protein 110 Gene [Source:MGI (curated);Acc:Cep110-012]
RefSeq_peptide
NP_036148.2 
UniGene
Mm.231332 
MGI
MGI:1889576 
Uniprot/SWISSPROT
A2AL36 
Uniprot/SPTREMBL
B0R041 B0R042 Q61710 A2AS42 A2AS40 B2RXX1 
Human Ortholog
ENSG00000119397 (CEP110)
Omim not available
UniTrap UNI8510
Vector Insertion
Chr 2: 34996142 - 34999169
Public Clones RRO237 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000113032
Sequence
GTTTCCAGCCATAGTTCTCAGGCCACCAAGGACTCCGGTTTGGGTCTAAAGTACACAGCCTCAACTCCTCTTAGAAAACCACAGCCTGGACAGCAAGAAG

AAAAGGACAGCAGTGGACCTCTGCCTGCTTCAGGGTACTGGGTCTACTCCCCCATCAGAAGCACGCTGCATAAGTCATTTTCAAAGAGAG AAGATGCAG

ACAGTGGAGGAGATAGCCAGGAAGAAAGTGGACTGGATGACCAGGAGGAACCCCCATTTGTGCCTCCCCCTGGGTACATAATGTATACTGTACTTCCTGA

TGGTTCTCCTGTACCCCAGGGAGTGGCCCTGTATGCACCATCGCCTCCATTGCCCAACAGCAGCCATCCTCTGACCCCCGGCACTGTGGTTTATGGGCCA

CCTCCTGCTGGGGCCCCCATCATATACGGACCTCCTCCTGCCAACTTCGCTGTTCCCCTTGTCCCCGCGGGTGTGCAGCATTGCAACATCCCAGAGCACC

ATAACCTA GAGAATGAAGTGTCTAGACTAGAAGACATAATGCAGCACTTAAAATCAAAACAGCGGGAAGAGCGGCGGCAGAAAGCATCCACGCAGCATT

CTGAGGAAGAAGTGGATGGGCTGCACCGTGATATTGATGACCTTTTGCAAGAGAAGAAAGAATTAGAACTTGAAGTAGAAGAATTACATAGAACTATTGA

GAGACATCAACAACGAAA GGACTTCATTGATGGACATGTTGAGAATCTTATGACTGAACTAGAAATAGAAAAGTCTCTCAAACATCATGAGGATATCGT

AGATGAAATTGAGTGCCTAGAGAAAACTCTCCTGAAACGTCGCTCGGAACTCAGGGAAGCTGACCGACTTCTGGCGGAAGCCGAGAATGAGCTTGCATGC

ACCAAGGAGAAG ACAAAGAGTGCTGTTGAAAAATTCACTGATGCCAAGAGAAATTTATTACAAACCGAGTCAGACGCTGAGGCACTAGAAAAGAGAGCC

CAGGAGACTGCACTTAACCTTGTGAAAGCAGAGCAGCAGCTAAG ACTGCTCCAGGCTGATGCAGAGGACTTGGAGCAGCACAAAATCAAACAAGAAGAA

ATCTTGAAAGAAATAAACAAAGTTGTAGCAGCCAAAGATGCCGATTTCCAGTGTCTAAACGAGAAGAAGGAAAAACTGACAGAAGA GCTTCAGAGTCTG

CAGAGAGACATCAAGGCAGCGCAACACAGTGAGGATCACCACCTTCAGGTCCTTAGAGAGTCTGAGACTCTCCTTCAGGCCAAGAGAGCTGAGCTGGAAA

CACTGAAAAGCCAG GTGACAAGCCAGCAGCAGGAGTTGGCTGTCCTGGACTCAGAGTTGGGGCATAGAAGGGAGGAGCTGCTTCTACTCCAGGACAGCC

TCGCCCAGGCAAAAGCTGACCTCCAGGAAGCCCTGACACTGGGGGAGACGGAAGTTGCTGAGAAGTGCAGTCACATTAGG GAAGTAAAATCACTTCTGG

AAGAACTAAGTTTTCAGAAAGGAGAACTGAATGTCCACATCAGTGAAAAGAAGACTCAGCTCGCACTTATACAGCAGGAGATGGAGAAAGAGGAAAAGAA

TCTTCAGGTGGTTTTACAGCAGCTGTCGAGACATAAGACTG AACTAAAGAATGTTGCAGACATACTGCAGCTTGAAACCAGCGAGCTCCAAGGTCTGAA

GCTCCAGCATGACCAGAAGGTGGTGGAGCTGGAGAAGGCGCAGGTGGACGTGCTGGAG GAGAAACTAGAGCTGGAGAATTTGCAGCAGGCAACGCAGCA

GCAGAGAAGGGAGCTAGAGCGGCAGAGACAGCTCCTGGAGAGAGACAGGCGGGAGACAGAGCGAGTGAGGGCAGAGAGCCAGGCCCTGCAGTCCTGCGTC

GAATGTCTGAGTAAAGAAAAGGAGGATCTCCAAGGACAGTGCGAGAGCTGGGAAAAGAAGTCTTCCCACGCCCAAAG AGTTCTAGCAGCCACAGAAGAA

AGCAACAAAATGGAGCAGTCCAACCTTGGGAAGTTGGAACTGAGTGTCAGAAAGCTGCGGCAGGAGCTGGAGCAGCTGAGCCAAGACAAGCTTGCCCTAC

ACAGTGAGGTAGCCGAGGTGCAGCAGCAGCTACAAG GTAAACAGGAAGCCATAAACTCTCTGCAGGAGGAACTGGATAGCACCCAAGACCATTTGGACC

TAGCAAAGCAG GACCTGATCCACACCACCAAGTGCCAGAACGAGTTGCTCAATGAGCAGACGCAGCTGCAGGAGGACATCAGCAAATGGATGGCCAGGT

TAGAGAGCTGCCAGAAAGAGACGGAGACAAAGGAACAGCAAGTCCAGCAGCTCCAGGATGAGATCAGAGAGAGCAAGCTCCGGCTGGACCAGCAGGAGAT

G ATGTTTCAAAAACTCCAGAAAGAAAGAGAACGTGAGGAGCAGAAGTTCGAGGCTGGTAAAGTGACGCTGGAGCAGCAGCAGAGGCAGCTGGAGAAGGA

GCTGACGGACCAGAAAAGCAGGCTGAAGCAGCTGCTCACAGACGTGTCGGCAGCTGAAGGACGCCTGGGAACCCTGCAGGAAGAGGAGCGGCGCATTGAG

GGCCTGGAGAGGATGCTGTCCCAGGCCA AACAGCAGCTTTCAGAACGGGAGCAGCAGCTAATGGCCAAGTCAGGTGAGCTGCTGGCCCTGCAGAAAGAG

GCTGACGATATGAGGGCCGACTTCAGCCTCCTGAGGAACCAGTTCTTAACAGAAAGGAAGAAGGCAGAGAAGCAGGTGGCCGGGCTAAAGGAAGCACTGA

AGATCCAGCGCAGTCAGCTGGAGAAAAACCTCCTG GAGCAGAAGCAGGAGAACAGCTGCATGCAAAAGGAAATGGCTACAATTGAGCTGGTGGCCCAGG

ACAACCACGAGAGGGCCAGGCGCCTCATGAAGGAGCTGAGCCAGATGCAGCAGGAGTACCTGGAACTCAAGAAACAG GTAGCAAACCAGAAAGACTTGG

AGAGGAGGCAGATGGAGGTCAGTGACGCAATGAGGACGCTGAAGTCGGAGGTGAAAGACGAAATCAGAACCAGTCTGAGGAACCTCAACCAGTTCCTTCC

AGAACTTCCAGCAGATCTAGCGTCTATTTTGGAAAGAAATGAAAACTTAAGAGAGTTGGAAAGCTTGAAAGAGAACTTCCCGTTTACCACAAAAGAGAGG

ATTTTTGAAGAAAAATCCAACTTTCCCCAAGTTCACATCATG GATGAACACTGGCGTGGAGAAGCACTCCGTCAAAGGCTGCGCCGCCATGAAGATCAA

CTCAAG GCTCAACTTCGACACTGTATGTCTAAGCAAGCAGAAGTATTGATCAAAGGAAAGCAGCAGACAGAGGGCACCCTACACAGTCTGAGGAGACAA

GTTGATGCTTTAGGAGAACTGGTCACTAGTACCTCCACAGACTCAGCATCATCACCCAGTCTGCCTTCCCTTGTGGAGGACTCCCAGCATGGGCATAGTC

AG AGCTCCTTCCAAGTTCTGCAAGTTCCATTAGAAGAACCAAACAGTTACCGCCACTAAGTTTCCTGCTTGCAG GAAAAGAAGCTCCAGCCAAGGTCA

GGAATACAGCCATGTGTAACCATAAGAGGAAATAGCTACTCTCCTACCTCACTGACATCCTAATGGAATGTCAATCAAGATCCTGTGAAGACTGAAAATG

CATTGTAGTTTGTACCATTTATACCGAGGTGTCTGTAAATCACATGCACTTGTGGGACTAGATGTGTGTATCTAACATAGGATGTAAGGGGCTATTTTTG

ACTCTCCTCCTCCTCCAATGATGAAATATTTTTTAAAGACAGTGAAACCACATATACTGAGTCCATAACTGGTATGTCTAGTTACCATGGAAAAGAATGT

ACTAAAAGCCCCTAGGCTTAATTAATAAGTTATTATTTTTGATTCTGATCCAAAGTTTATTTTTAATATGAAAATAAAGGTACAGTCAACTTGTGTCTGT

CA
Translation
 MYTVLPDGSPVPQGVALYAPSPPLPNSSHPLTPGTVVYGPPPAGAPIIYGPPPANFAVPLVPAGVQHCNIPEHHNL ENEVSRLEDIMQHLKSKQREER

RQKASTQHSEEEVDGLHRDIDDLLQEKKELELEVEELHRTIERHQQRK KDFIDGHVENLMTELEIEKSLKHHEDIVDEIECLEKTLLKRRSELREADRL

LAEAENELACTKEK TKSAVEKFTDAKRNLLQTESDAEALEKRAQETALNLVKAEQQLR RLLQADAEDLEQHKIKQEEILKEINKVVAAKDADFQCLNE

KKEKLTEE ELQSLQRDIKAAQHSEDHHLQVLRESETLLQAKRAELETLKSQ VTSQQQELAVLDSELGHRREELLLLQDSLAQAKADLQEALTLGETEV

AEKCSHIR EVKSLLEELSFQKGELNVHISEKKTQLALIQQEMEKEEKNLQVVLQQLSRHKTE ELKNVADILQLETSELQGLKLQHDQKVVELEKAQVD

VLE EKLELENLQQATQQQRRELERQRQLLERDRRETERVRAESQALQSCVECLSKEKEDLQGQCESWEKKSSHAQR RVLAATEESNKMEQSNLGKLEL

SVRKLRQELEQLSQDKLALHSEVAEVQQQLQG GKQEAINSLQEELDSTQDHLDLAKQ DLIHTTKCQNELLNEQTQLQEDISKWMARLESCQKETETKE

QQVQQLQDEIRESKLRLDQQEM MFQKLQKEREREEQKFEAGKVTLEQQQRQLEKELTDQKSRLKQLLTDVSAAEGRLGTLQEEERRIEGLERMLSQAK 

KQQLSEREQQLMAKSGELLALQKEADDMRADFSLLRNQFLTERKKAEKQVAGLKEALKIQRSQLEKNLL EQKQENSCMQKEMATIELVAQDNHERARRL

MKELSQMQQEYLELKKQ VANQKDLERRQMEVSDAMRTLKSEVKDEIRTSLRNLNQFLPELPADLASILERNENLRELESLKENFPFTTKERIFEEKSNF

PQVHIM DEHWRGEALRQRLRRHEDQLK AQLRHCMSKQAEVLIKGKQQTEGTLHSLRRQVDALGELVTSTSTDSASSPSLPSLVEDSQHGHSQ SSFQV

LQVPLEEPNSYRH 
Transcript ENSMUST00000045111
Sequence
ATGGATGCAGAAAATATGAGGAAG GAGCTTGCAGAGCTAGAAAGTGCCCTCCAGGAACAGCATGAGGTGAATGCATCCCTACAGCAAGCCCAGGGAGAT

CTCAGCGCCTATGAAACTGAGCTAGAGACTCAGTTAAAACTAAAAGACGCTGAAACCAGCCAGCTCAAGCAAGAGTTGGAAAAACTCCTAAGGCGTACTC

AG TTAGAGCAATCGGTGCTTCAAACAGAACTGGAGAAGGAGAGAGAATCCCTCAGGGATGCCCTGGGCAAAGCCCAGTCCTCAGAAGAGAAACAACAGG

AGAACAACGAGCTCCGTACACAGCTGAAGCAGCTGCAG - UNI8510 - GATGACAACAGCCTGTTAAAGAAGCAGCTGAAAGAGTTTCAGAATCACC

TTAACCATGTGGTTGATGGTCTG TCACCCAGAGGAAGTAGCAGCTCGTGTAGACGAGCTAAGGAAAAGGTTGAAACTAGGAGCTGGGGAAATGAG AGA

ATCCATAGTCCTTCAGATGTCTTAGGGAAAAGTCTTGCTGACCTACAGAAACAGTTCAGTGAAATCCTTGCACGATCCCAGTGGGAAAAAGAGGAAGCCC

AAGTTAGAGAGAGGAAGCTCCATGAAGAAATGGCTCTCCAGCAAGAGAAACTGGCGAATGGTCAAGAGGAGTTCAGGCAGGCCTGCGAAAG ATTAAGGC

AAGCATTCAAATCCCAGAGAACAAG CTATTTAGTACAAAACCTTGTTATGTTCCCTAGTAAGGAAAT TATTTCCTCACAGATTAAGTTTGATAAAAGA

CAACATAATGCAAGAATCCAGCAATTAGAAAATGAAATTCACTATTTGCAAGAGAACCTAAAAAGTATGGAAAAAATCCAAGGCCTTACAGACCTTCAGC

TTCAGGAAGCAGATGAAGAGAAGGAAAGAATTCTGGCCCAACTCCAGGAGTTAGAGAAAAAG AAGAAGCGTGAAGATGCCAGATCTCAGGAACAGTTTC

TTGGTTTAGATGAAGAACTGAAGAGTCTGAAGAAAGCGGTGGCTGCTTCTGATAAATTAGCTGCGGCTGAGCTCACCATTGCCAAAGACCAGCTCAAGTC

CCTGCACGGAACTGTTGTGAGAATTAATCAGGAGCGAGCAGAG GAGCTGCAGGAGGCAGAGAGGTTCAGCAGAGAGGCCATGCAAGCAGCCAAGGACCT

GAGCAGAGCGGAGGCAGAGATCGAGCTCCTGCAGCACCTTCTCAGGGAGAGAGAGGGCCAG TTCCGAGATGAGATGGAAAATGCAGATTTAGGTGCTAA

AGGAGCAAACTCCCAGCTGCTAGAGATTGAGGCGCTGAACGAGGCCATGGCGAAGCAAAGAGCTGAGATCACGAGACTCCGGGATGTATTAAACCTCACG

GGGGCAG GTACAAAAGGAGGCATTGAGAACGTGTTAGAGGAAATCGCTGAGCTCCGGCATGCAGTCTCTGCTCAGAACGAGTACATCAGCAGCATGGCA

GATCCTTTCAGAAGACAAGGCTGGTGGTACTTTATGCCACCAGCACCATCCTCAAAA GTTTCCAGCCATAGTTCTCAGGCCACCAAGGACTCCGGTTTG

GGTCTAAAGTACACAGCCTCAACTCCTCTTAGAAAACCACAGCCTGGACAGCAAGAAGAAAAGGACAGCAGTGGACCTCTGCCTGCTTCAGGGTACTGGG

TCTACTCCCCCATCAGAAGCACGCTGCATAAGTCATTTTCAAAGAGAG AAGATGCAGACAGTGGAGGAGATAGCCAGGAAGAAAGTGGACTGGATGACC

AGGAGGAACCCCCATTTGTGCCTCCCCCTGGGTACATAATGTATACTGTACTTCCTGATGGTTCTCCTGTACCCCAGGGAGTGGCCCTGTATGCACCATC

GCCTCCATTGCCCAACAGCAGCCATCCTCTGACCCCCGGCACTGTGGTTTATGGGCCACCTCCTGCTGGGGCCCCCATCATATACGGACCTCCTCCTGCC

AACTTCGCTGTTCCCCTT CCGCGGGTGTGCAGCATTGCAACATCCCAGAGCACCATAACCTAG
Translation
MDAENMRK ELAELESALQEQHEVNASLQQAQGDLSAYETELETQLKLKDAETSQLKQELEKLLRRTQ LEQSVLQTELEKERESLRDALGKAQSSEEKQ

QENNELRTQLKQLQ - UNI8510 - DDNSLLKKQLKEFQNHLNHVVDGL SPRGSSSSCRRAKEKVETRSWGNE RIHSPSDVLGKSLADLQKQFSEI

LARSQWEKEEAQVRERKLHEEMALQQEKLANGQEEFRQACER RLRQAFKSQRTS SYLVQNLVMFPSKEI IISSQIKFDKRQHNARIQQLENEIHYLQ

ENLKSMEKIQGLTDLQLQEADEEKERILAQLQELEKK KKREDARSQEQFLGLDEELKSLKKAVAASDKLAAAELTIAKDQLKSLHGTVVRINQERAE E

LQEAERFSREAMQAAKDLSRAEAEIELLQHLLREREGQ FRDEMENADLGAKGANSQLLEIEALNEAMAKQRAEITRLRDVLNLTGAG GTKGGIENVLE

EIAELRHAVSAQNEYISSMADPFRRQGWWYFMPPAPSSK VSSHSSQATKDSGLGLKYTASTPLRKPQPGQQEEKDSSGPLPASGYWVYSPIRSTLHKSF

SKRE EDADSGGDSQEESGLDDQEEPPFVPPPGYIMYTVLPDGSPVPQGVALYAPSPPLPNSSHPLTPGTVVYGPPPAGAPIIYGPPPANFAVPL PRVC

SIATSQSTIT
Transcript ENSMUST00000113033
Sequence
GCTTGCCAAGATGTGGCTGTCAGAGAGGGAAGTGCACATGAATTTGAAGACAGACTTAGAAAGCTTTGCGCAGCCTGTTTTTGTTCCCCACGGCTCTGTC

ATAACAGGAAAGATTCGGAGTTAAGGTATGGTCGTTCCTCTGTGTATAAAGAAAGGGCTTGGACGGAGGAGGAGCCAGATCT TCCCACATGAAAGCCCA

GAAGAGGGGCAAAGAACAGCAGCTTGACATTATGAACAGACAGTACACACAGCTCGAAAGCCGCCTGGACGAGATACTTTGTAGAATTGCCAAAGAGACT

GAAGAGATCAAGGACCTTGAACAGCAGCTTACAGATG GCCAGATAGCAGCAAACGAAGCTCTGAAGAAGGATTTAGAAGGTGTCATCAGTGGGTTGCAA

GAGTACCTTGGAACCATCAAAGGCCAGGCAACTCAGGCCCAGAATGAGTGCAGGAAGCTACAGGATGAGAAAGAGACATTGCTGCAGAGACTGACAGAAG

TCCAGCAGGAGAAGGAGGAACTTGAACTCATTGCCATGGATGCAGAAAATATGAGGAAG GAGCTTGCAGAGCTAGAAAGTGCCCTCCAGGAACAGCATG

AGGTGAATGCATCCCTACAGCAAGCCCAGGGAGATCTCAGCGCCTATGAAACTGAGCTAGAGACTCAGTTAAAACTAAAAGACGCTGAAACCAGCCAGCT

CAAGCAAGAGTTGGAAAAACTCCTAAGGCGTACTCAG TTAGAGCAATCGGTGCTTCAAACAGAACTGGAGAAGGAGAGAGAATCCCTCAGGGATGCCCT

GGGCAAAGCCCAGTCCTCAGAAGAGAAACAACAGGAGAACAACGAGCTCCGTACACAGCTGAAGCAGCTGCAG - UNI8510 - GATGACAACAGCCT

GTTAAAGAAGCAGCTGAAAGAGTTTCAGAATCACCTTAACCATGTGGTTGATGGTCTGATTCACCCAGAGGAAGTAGCAGCTCGTGTAGACGAGCTAAGG

AAAAGGTTGAAACTAGGAGCTGGGGAAATGAG AATCCATAGTCCTTCAGATGTCTTAGGGAAAAGTCTTGCTGACCTACAGAAACAGTTCAGTGAAATC

CTTGCACGATCCCAGTGGGAAAAAGAGGAAGCCCAAGTTAGAGAGAGGAAGCTCCATGAAGAAATGGCTCTCCAGCAAGAGAAACTGGCGAATGGTCAAG

AGGAGTTCAGGCAGGCCTGCGAAAGAGCACTTGAAGCCAGA ATTAAGTTTGATAAAAGACAACATAATGCAAGAATCCAGCAATTAGAAAATGAAATTC

ACTATTTGCAAGAGAACCTAAAAAGTATGGAAAAAATCCAAGGCCTTACAGACCTTCAGCTTCAGGAAGCAGATGAAGAGAAGGAAAGAATTCTGGCCCA

ACTCCAGGAGTTAGAGAAAAAG AAGAAGCGTGAAGATGCCAGATCTCAGGAACAGTTTCTTGGTTTAGATGAAGAACTGAAGAGTCTGAAGAAAGCGGT

GGCTGCTTCTGATAAATTAGCTGCGGCTGAGCTCACCATTGCCAAAGACCAGCTCAAGTCCCTGCACGGAACTGTTGTGAGAATTAATCAGGAGCGAGCA

GAGGTCGGTACCCAAGTCAGTCAGGATGTGCTCATCAGCACTGTCTCAGAGTGA
Translation
 MKAQKRGKEQQLDIMNRQYTQLESRLDEILCRIAKETEEIKDLEQQLTDG GQIAANEALKKDLEGVISGLQEYLGTIKGQATQAQNECRKLQDEKETL

LQRLTEVQQEKEELELIAMDAENMRK ELAELESALQEQHEVNASLQQAQGDLSAYETELETQLKLKDAETSQLKQELEKLLRRTQ LEQSVLQTELEKE

RESLRDALGKAQSSEEKQQENNELRTQLKQLQ - UNI8510 - DDNSLLKKQLKEFQNHLNHVVDGLIHPEEVAARVDELRKRLKLGAGEMR RIHSP

SDVLGKSLADLQKQFSEILARSQWEKEEAQVRERKLHEEMALQQEKLANGQEEFRQACERALEAR IKFDKRQHNARIQQLENEIHYLQENLKSMEKIQG

LTDLQLQEADEEKERILAQLQELEKK KKREDARSQEQFLGLDEELKSLKKAVAASDKLAAAELTIAKDQLKSLHGTVVRINQERAEVGTQVSQDVLIST

VSE
Transcript ENSMUST00000113034
Sequence
TTGCCAAGATGTGGCTGTCAGAGAGGGAAGTGCACATGAATTTGAAGACAGACTTAGAAAGCTTTGCGCAGCCTGTTTTTGTTCCCCACGGCTCTGTCAT

AACAGGAAAGATTCGGAGTTAAGGTATGGTCGTTCCTCTGTGTATAAAGAAAGGGCTTGGACGGAGGAGGAGCCAGATCT TCCCACATGAAAGCCCAGA

AGAGGGGCAAAGAACAGCAGCTTGACATTATGAACAGACAGTACACACAGCTCGAAAGCCGCCTGGACGAGATACTTTGTAGAATTGCCAAAGAGACTGA

AGAGATCAAGGACCTTGAACAGCAGCTTACAGATG GCCAGATAGCAGCAAACGAAGCTCTGAAGAAGGATTTAGAAGGTGTCATCAGTGGGTTGCAAGA

GTACCTTGGAACCATCAAAGGCCAGGCAACTCAGGCCCAGAATGAGTGCAGGAAGCTACAGGATGAGAAAGAGACATTGCTGCAGAGACTGACAGAAGTC

CAGCAGGAGAAGGAGGAACTTGAACTCATTGCCATGGATGCAGAAAATATGAGGAAG GAGCTTGCAGAGCTAGAAAGTGCCCTCCAGGAACAGCATGAG

GTGAATGCATCCCTACAGCAAGCCCAGGGAGATCTCAGCGCCTATGAAACTGAGCTAGAGACTCAGTTAAAACTAAAAGACGCTGAAACCAGCCAGCTCA

AGCAAGAGTTGGAAAAACTCCTAAGGCGTACTCAG TTAGAGCAATCGGTGCTTCAAACAGAACTGGAGAAGGAGAGAGAATCCCTCAGGGATGCCCTGG

GCAAAGCCCAGTCCTCAGAAGAGAAACAACAGGAGAACAACGAGCTCCGTACACAGCTGAAGCAGCTGCAG - UNI8510 - GATGACAACAGCCTGT

TAAAGAAGCAGCTGAAAGAGTTTCAGAATCACCTTAACCATGTGGTTGATGGTCTGATTCACCCAGAGGAAGTAGCAGCTCGTGTAGACGAGCTAAGGAA

AAGGTTGAAACTAGGAGCTGGGGAAATGAG AATCCATAGTCCTTCAGATGTCTTAGGGAAAAGTCTTGCTGACCTACAGAAACAGTTCAGTGAAATCCT

TGCACGATCCCAGTGGGAAAAAGAGGAAGCCCAAGTTAGAGAGAGGAAGCTCCATGAAGAAATGGCTCTCCAGCAAGAGAAACTGGCGAATGGTCAAGAG

GAGTTCAGGCAGGCCTGCGAAAGAGCACTTGAAGCCAGA ATTAAGTTTGATAAAAGACAACATAATGCAAGAATCCAGCAATTAGAAAATGAAATTCAC

TATTTGCAAGAGAACCTAAAAAGTATGGAAAAAATCCAAGGCCTTACAGACCTTCAGCTTCAGGAAGCAGATGAAGAGAAGGAAAGAATTCTGGCCCAAC

TCCAGGAGTTAGAGAAAAAG AAGAAGCGTGAAGATGCCAGATCTCAGGAACAGTTTCTTGGTTTAGATGAAGAACTGAAGAGTCTGAAGAAAGCGGTGG

CTGCTTCTGATAAATTAGCTGCGGCTGAGCTCACCATTGCCAAAGACCAGCTCAAGTCCCTGCACGGAACTGTTGTGAGAATTAATCAGGAGCGAGCAGA

G GAGCTGCAGGAGGCAGAGAGGTTCAGCAGAGAGGCCATGCAAGCAGCCAAGGACCTGAGCAGAGCGGAGGCAGAGATCGAGCTCCTGCAGCACCTTCT

CAGGGAGAGAGAGGGCCAG TTCCGAGATGAGATGGAAAATGCAGATTTAGGTGCTAAAGGAGCAAACTCCCAGCTGCTAGAGATTGAGGCGCTGAACGA

GGCCATGGCGAAGCAAAGAGCTGAGATCACGAGACTCCGGGATGTATTAAACCTCACGGGGGCAG GTACAAAAGGAGGCATTGAGAACGTGTTAGAGGA

AATCGCTGAGCTCCGGCATGCAGTCTCTGCTCAGAACGAGTACATCAGCAGCATGGCAGATCCTTTCAGAAGACAAGGCTGGTGGTACTTTATGCCACCA

GCACCATCCTCAAAA GTTTCCAGCCATAGTTCTCAGGCCACCAAGGACTCCGGTTTGGGTCTAAAGTACACAGCCTCAACTCCTCTTAGAAAACCACAG

CCTGGACAGCAAGAAGAAAAGGACAGCAGTGGACCTCTGCCTGCTTCAGGGTACTGGGTCTACTCCCCCATCAGAAGCACGCTGCATAAGTCATTTTCAA

AGAGAG AAGATGCAGACAGTGGAGGAGATAGCCAGGAAGAAAGTGGACTGGATGACCAGGAGGAACCCCCATTTGTGCCTCCCCCTGGGTACATAATGT

ATACTGTACTTCCTGATGGTTCTCCTGTACCCCAGGGAGTGGCCCTGTATGCACCATCGCCTCCATTGCCCAACAGCAGCCATCCTCTGACCCCCGGCAC

TGTGGTTTATGGGCCACCTCCTGCTGGGGCCCCCATCATATACGGACCTCCTCCTGCCAACTTCGCTGTTCCCCTTGTCCCCGCGGGTGTGCAGCATTGC

AACATCCCAGAGCACCATAACCTA GAGAATGAAGTGTCTAGACTAGAAGACATAATGCAGCACTTAAAATCAAAACAGCGGGAAGAGCGGCGGCAGAAA

GCATCCACGCAGCATTCTGAGGAAGAAGTGGATGGGCTGCACCGTGATATTGATGACCTTTTGCAAGAGAAGAAAGAATTAGAACTTGAAGTAGAAGAAT

TACATAGAACTATTGAGAGACATCAACAACGAAA GGACTTCATTGATGGACATGTTGAGAATCTTATGACTGAACTAGAAATAGAAAAGTCTCTCAAAC

ATCATGAGGATATCGTAGATGAAATTGAGTGCCTAGAGAAAACTCTCCTGAAACGTCGCTCGGAACTCAGGGAAGCTGACCGACTTCTGGCGGAAGCCGA

GAATGAGCTTGCATGCACCAAGGAGAAG ACAAAGAGTGCTGTTGAAAAATTCACTGATGCCAAGAGAAATTTATTACAAACCGAGTCAGACGCTGAGGC

ACTAGAAAAGAGAGCCCAGGAGACTGCACTTAACCTTGTGAAAGCAGAGCAGCAGCTAAG ACTGCTCCAGGCTGATGCAGAGGACTTGGAGCAGCACAA

AATCAAACAAGAAGAAATCTTGAAAGAAATAAACAAAGTTGTAGCAGCCAAAGATGCCGATTTCCAGTGTCTAAACGAGAAGAAGGAAAAACTGACAGAA

GA GCTTCAGAGTCTGCAGAGAGACATCAAGGCAGCGCAACACAGTGAGGATCACCACCTTCAGGTCCTTAGAGAGTCTGAGACTCTCCTTCAGGCCAAG

AGAGCTGAGCTGGAAACACTGAAAAGCCAG GTGACAAGCCAGCAGCAGGAGTTGGCTGTCCTGGACTCAGAGTTGGGGCATAGAAGGGAGGAGCTGCTT

CTACTCCAGGACAGCCTCGCCCAGGCAAAAGCTGACCTCCAGGAAGCCCTGACACTGGGGGAGACGGAAGTTGCTGAGAAGTGCAGTCACATTAGG GAA

GTAAAATCACTTCTGGAAGAACTAAGTTTTCAGAAAGGAGAACTGAATGTCCACATCAGTGAAAAGAAGACTCAGCTCGCACTTATACAGCAGGAGATGG

AGAAAGAGGAAAAGAATCTTCAGGTGGTTTTACAGCAGCTGTCGAGACATAAGACTG AACTAAAGAATGTTGCAGACATACTGCAGCTTGAAACCAGCG

AGCTCCAAGGTCTGAAGCTCCAGCATGACCAGAAGGTGGTGGAGCTGGAGAAGGCGCAGGTGGACGTGCTGGAG GAGAAACTAGAGCTGGAGAATTTGC

AGCAGGCAACGCAGCAGCAGAGAAGGGAGCTAGAGCGGCAGAGACAGCTCCTGGAGAGAGACAGGCGGGAGACAGAGCGAGTGAGGGCAGAGAGCCAGGC

CCTGCAGTCCTGCGTCGAATGTCTGAGTAAAGAAAAGGAGGATCTCCAAGGACAGTGCGAGAGCTGGGAAAAGAAGTCTTCCCACGCCCAAAG AGTTCT

AGCAGCCACAGAAGAAAGCAACAAAATGGAGCAGTCCAACCTTGGGAAGTTGGAACTGAGTGTCAGAAAGCTGCGGCAGGAGCTGGAGCAGCTGAGCCAA

GACAAGCTTGCCCTACACAGTGAGGTAGCCGAGGTGCAGCAGCAGCTACAAG GTAAACAGGAAGCCATAAACTCTCTGCAGGAGGAACTGGATAGCACC

CAAGACCATTTGGACCTAGCAAAGCAG GACCTGATCCACACCACCAAGTGCCAGAACGAGTTGCTCAATGAGCAGACGCAGCTGCAGGAGGACATCAGC

AAATGGATGGCCAGGTTAGAGAGCTGCCAGAAAGAGACGGAGACAAAGGAACAGCAAGTCCAGCAGCTCCAGGATGAGATCAGAGAGAGCAAGCTCCGGC

TGGACCAGCAGGAGATG ATGTTTCAAAAACTCCAGAAAGAAAGAGAACGTGAGGAGCAGAAGTTCGAGGCTGGTAAAGTGACGCTGGAGCAGCAGCAGA

GGCAGCTGGAGAAGGAGCTGACGGACCAGAAAAGCAGGCTGAAGCAGCTGCTCACAGACGTGTCGGCAGCTGAAGGACGCCTGGGAACCCTGCAGGAAGA

GGAGCGGCGCATTGAGGGCCTGGAGAGGATGCTGTCCCAGGCCA AACAGCAGCTTTCAGAACGGGAGCAGCAGCTAATGGCCAAGTCAGGTGAGCTGCT

GGCCCTGCAGAAAGAGGCTGACGATATGAGGGCCGACTTCAGCCTCCTGAGGAACCAGTTCTTAACAGAAAGGAAGAAGGCAGAGAAGCAGGTGGCCGGG

CTAAAGGAAGCACTGAAGATCCAGCGCAGTCAGCTGGAGAAAAACCTCCTG GAGCAGAAGCAGGAGAACAGCTGCATGCAAAAGGAAATGGCTACAATT

GAGCTGGTGGCCCAGGACAACCACGAGAGGGCCAGGCGCCTCATGAAGGAGCTGAGCCAGATGCAGCAGGAGTACCTGGAACTCAAGAAACAG GTAGCA

AACCAGAAAGACTTGGAGAGGAGGCAGATGGAGGTCAGTGACGCAATGAGGACGCTGAAGTCGGAGGTGAAAGACGAAATCAGAACCAGTCTGAGGAACC

TCAACCAGTTCCTTCCAGAACTTCCAGCAGATCTAGCGTCTATTTTGGAAAGAAATGAAAACTTAAGAGAGTTGGAAAGCTTGAAAGAGAACTTCCCGTT

TACCACAAAAGAGAGGATTTTTGAAGAAAAATCCAACTTTCCCCAAGTTCACATCATG GATGAACACTGGCGTGGAGAAGCACTCCGTCAAAGGCTGCG

CCGCCATGAAGATCAACTCAAG GCTCAACTTCGACACTGTATGTCTAAGCAAGCAGAAGTATTGATCAAAGGAAAGCAGCAGACAGAGGGCACCCTACA

CAGTCTGAGGAGACAAGTTGATGCTTTAGGAGAACTGGTCACTAGTACCTCCACAGACTCAGCATCATCACCCAGTCTGCCTTCCCTTGTGGAGGACTCC

CAGCATGGGCATAGTCAG AGCTCCTTCCAAGTTCTGCAAGTTCCATTAGAAGAACCAAACAGTTACCGCCACTAAGTTTCCTGCTTGCAG GAAAAGAA

GCTCCAGCCAAGGTCAGGAATACAGCCATGTGTAACCATAAGAGGAAATAGCTACTCTCCTACCTCACTGACATCCTAATGGAATGTCAATCAAGATCCT

GTGAAGACTGAAAATGCATTGTAGTTTGTACCATTTATACCGAGGTGTCTGTAAATCACATGCACTTGTGGGACTAGATGTGTGTATCTAACATAGGATG

TAAGGGGCTATTTTTGACTCTCCTCCTCCTCCAATGATGAAATATTTTTTAAAGACAGTGAAACCACATATACTGAGTCCATAACTGGTATGTCTAGTTA

CCATGGAAAAGAATGTACTAAAAGCCCCTAGGCTTAATTAATAAGTTATTATTTTTGATTCTGATCCAAAGTTTATTTTTAATATGAAAATAAAGGTACA

GTCAACTTGTGTCTGTCA
Translation
 MKAQKRGKEQQLDIMNRQYTQLESRLDEILCRIAKETEEIKDLEQQLTDG GQIAANEALKKDLEGVISGLQEYLGTIKGQATQAQNECRKLQDEKETL

LQRLTEVQQEKEELELIAMDAENMRK ELAELESALQEQHEVNASLQQAQGDLSAYETELETQLKLKDAETSQLKQELEKLLRRTQ LEQSVLQTELEKE

RESLRDALGKAQSSEEKQQENNELRTQLKQLQ - UNI8510 - DDNSLLKKQLKEFQNHLNHVVDGLIHPEEVAARVDELRKRLKLGAGEMR RIHSP

SDVLGKSLADLQKQFSEILARSQWEKEEAQVRERKLHEEMALQQEKLANGQEEFRQACERALEAR IKFDKRQHNARIQQLENEIHYLQENLKSMEKIQG

LTDLQLQEADEEKERILAQLQELEKK KKREDARSQEQFLGLDEELKSLKKAVAASDKLAAAELTIAKDQLKSLHGTVVRINQERAE ELQEAERFSREA

MQAAKDLSRAEAEIELLQHLLREREGQ FRDEMENADLGAKGANSQLLEIEALNEAMAKQRAEITRLRDVLNLTGAG GTKGGIENVLEEIAELRHAVSA

QNEYISSMADPFRRQGWWYFMPPAPSSK VSSHSSQATKDSGLGLKYTASTPLRKPQPGQQEEKDSSGPLPASGYWVYSPIRSTLHKSFSKRE EDADSG

GDSQEESGLDDQEEPPFVPPPGYIMYTVLPDGSPVPQGVALYAPSPPLPNSSHPLTPGTVVYGPPPAGAPIIYGPPPANFAVPLVPAGVQHCNIPEHHNL

 ENEVSRLEDIMQHLKSKQREERRQKASTQHSEEEVDGLHRDIDDLLQEKKELELEVEELHRTIERHQQRK KDFIDGHVENLMTELEIEKSLKHHEDIV

DEIECLEKTLLKRRSELREADRLLAEAENELACTKEK TKSAVEKFTDAKRNLLQTESDAEALEKRAQETALNLVKAEQQLR RLLQADAEDLEQHKIKQ

EEILKEINKVVAAKDADFQCLNEKKEKLTEE ELQSLQRDIKAAQHSEDHHLQVLRESETLLQAKRAELETLKSQ VTSQQQELAVLDSELGHRREELLL

LQDSLAQAKADLQEALTLGETEVAEKCSHIR EVKSLLEELSFQKGELNVHISEKKTQLALIQQEMEKEEKNLQVVLQQLSRHKTE ELKNVADILQLET

SELQGLKLQHDQKVVELEKAQVDVLE EKLELENLQQATQQQRRELERQRQLLERDRRETERVRAESQALQSCVECLSKEKEDLQGQCESWEKKSSHAQR

 RVLAATEESNKMEQSNLGKLELSVRKLRQELEQLSQDKLALHSEVAEVQQQLQG GKQEAINSLQEELDSTQDHLDLAKQ DLIHTTKCQNELLNEQTQ

LQEDISKWMARLESCQKETETKEQQVQQLQDEIRESKLRLDQQEM MFQKLQKEREREEQKFEAGKVTLEQQQRQLEKELTDQKSRLKQLLTDVSAAEGR

LGTLQEEERRIEGLERMLSQAK KQQLSEREQQLMAKSGELLALQKEADDMRADFSLLRNQFLTERKKAEKQVAGLKEALKIQRSQLEKNLL EQKQENS

CMQKEMATIELVAQDNHERARRLMKELSQMQQEYLELKKQ VANQKDLERRQMEVSDAMRTLKSEVKDEIRTSLRNLNQFLPELPADLASILERNENLRE

LESLKENFPFTTKERIFEEKSNFPQVHIM DEHWRGEALRQRLRRHEDQLK AQLRHCMSKQAEVLIKGKQQTEGTLHSLRRQVDALGELVTSTSTDSAS

SPSLPSLVEDSQHGHSQ SSFQVLQVPLEEPNSYRH 
Transcript ENSMUST00000113037
Sequence
GCCCACACCAAGCTGGCCCTCTCGGCAACCGGCACAACACAACAAAATGGCTGCTGTGCTGTCGGTCTCCTGAGGGGAAGTATCCCGGCGTCTCCGCCTC

GCCCCTCCCGCTAGGCCGTTCCTTCCCGTGCTGAGGCG GTTTTGATGGCCACCTGGTTTTATTCTTGCAATGAAGAAAGGTTCTGAACGAAGGCTCTCC

AAAGCAAAGATGCCGCTGTCATCTCATTTTCCTGGGCCATCATCTCTTAGGTCCAGCATGCGATCTAGGTCCCTTTCACCTTTAATTGGATCTGAGACTC

AGCCTTTACATCCTGGCGGACAGTGGCCTGCACAGGCTGAGCTGACAGATGAAAGCACTGTGCCTTTGGAGCCCCAGCAACGTAAAG GAGCTGAGTCAT

ATGTAGGAGTCCGGTATATTACAGAAGCCCTCATCAAAAAACTCACTAAACAGGACAATTTGGCCTTGGTGAAGTCTCTGAATCTTTCACTTTCTAAAGA

TGGCGGCAAGAAATTTAGG TACATCGAAAATTTGGAAAAGTGTGTTAAACTTGAAGTACTAAATCTCAGCTATAATCTAATAGTGAAGATAGAGAAAGT

GGACAAGCTGTTACGATTACGTGAACTCAACTTATCATATAACAAAATCAG CAAAATTGAAGGACTAGAAAACATGTGTAACCTGCAGAAGCTAAACCT

AGCAGGTAATGAAATCGAGCATATTCCAGTGTGGTTCGCAAAGAAATTGAAATCTTTACGAGTCCTCAATCTGAAAGGCAATAAGATATCATCG CTCCA

GGATGTAAGCAAGTTGAAGCCACTTCAAGATTTGACTTCTTTAGTCCTCATTGACAATCCAGTTGTGGCCCTTCCGCATTACCTCCAGTTCATCATTTTC

CACCTCCGTTCCCTGGAAAGTTTGGAAGGTCAGCCAGTAACCACTCAGGATAGACAAGAGGCTTTCGAGAGATTCAGCTTGG AGGAGATAGAAAGACTG

GAAAAAGACCTGGAGAAGAAGACAGTGGAAACAGAAGAGCTTAAGAACAAGCAAACAAAGTTTCTCGAGGAAATAAAGAATCAGGATAAACTAAACAAGT

CATTAAAAGAAGAAGCCATGTTACAAAAACAGAGCTGTGAGGAGCTAGAAAGTGACCTCAGCACAAAGAAGGAGTTG CTAAAACAGAAAACAGTGGAAC

TAACACGGGCATGTCAGAAGCAGTATGAGCTGGAGCAGGAACTGGCCTTTTATAAAATTGATGCCAAGTTTGAGCCATTAAATTATTATCCATCAGAG T

ATGCTGAAATTGACAAATACCCAGATGAAAGCCCTTACATTGGCAAATCCAGATACAAGAGAAATATGTTTGCCACGGAGACTTACATTGTCAGCGACGC

CCAGGCAGTTCAGATCAGGAAGATGGTGCCAGAAGGAGGACAGCTTAGACACGAGCACACACCCCCGAGAGTCCAAGCACCACCTGATCTACAGTTGGAA

GATACGGAAAAAAAAATAAGTGCAG CACAAACTCGACTGTCAGAACTACACCATGAAATAGAAACAGCAGAACAAAAAGTATTACGGGCTACTCAAGAA

TTTAAACAACTGGAAGAAGCTATACAACAAAAAAAG ATTTCAGAAGCAGAGAAAGACCTCCTTCTCAAGCAGTTGAGTGGTAGACTACAACATCTAAAC

AGATTACGCCAGGAAGCTCTGGACCTAGAAATACAGATGGAAAAGCAAAGAAAAGAAATTGCCGAAAAGCATGAAGAGATCAATACCGTGCAGCTAGCCA

CAGACAGCCTGGATCCCAAAGACCCAAAACAT TCCCACATGAAAGCCCAGAAGAGGGGCAAAGAACAGCAGCTTGACATTATGAACAGACAGTACACAC

AGCTCGAAAGCCGCCTGGACGAGATACTTTGTAGAATTGCCAAAGAGACTGAAGAGATCAAGGACCTTGAACAGCAGCTTACAGATG GCCAGATAGCAG

CAAACGAAGCTCTGAAGAAGGATTTAGAAGGTGTCATCAGTGGGTTGCAAGAGTACCTTGGAACCATCAAAGGCCAGGCAACTCAGGCCCAGAATGAGTG

CAGGAAGCTACAGGATGAGAAAGAGACATTGCTGCAGAGACTGACAGAAGTCCAGCAGGAGAAGGAGGAACTTGAACTCATTGCCATGGATGCAGAAAAT

ATGAGGAAG GAGCTTGCAGAGCTAGAAAGTGCCCTCCAGGAACAGCATGAGGTGAATGCATCCCTACAGCAAGCCCAGGGAGATCTCAGCGCCTATGAA

ACTGAGCTAGAGACTCAGTTAAAACTAAAAGACGCTGAAACCAGCCAGCTCAAGCAAGAGTTGGAAAAACTCCTAAGGCGTACTCAG TTAGAGCAATCG

GTGCTTCAAACAGAACTGGAGAAGGAGAGAGAATCCCTCAGGGATGCCCTGGGCAAAGCCCAGTCCTCAGAAGAGAAACAACAGGAGAACAACGAGCTCC

GTACACAGCTGAAGCAGCTGCAG - UNI8510 - GATGACAACAGCCTGTTAAAGAAGCAGCTGAAAGAGTTTCAGAATCACCTTAACCATGTGGTTG

ATGGTCTGATTCACCCAGAGGAAGTAGCAGCTCGTGTAGACGAGCTAAGGAAAAGGTTGAAACTAGGAGCTGGGGAAATGAG AATCCATAGTCCTTCAG

ATGTCTTAGGGAAAAGTCTTGCTGACCTACAGAAACAGTTCAGTGAAATCCTTGCACGATCCCAGTGGGAAAAAGAGGAAGCCCAAGTTAGAGAGAGGAA

GCTCCATGAAGAAATGGCTCTCCAGCAAGAGAAACTGGCGAATGGTCAAGAGGAGTTCAGGCAGGCCTGCGAAAGAGCACTTGAAGCCAGA ATTAAGTT

TGATAAAAGACAACATAATGCAAGAATCCAGCAATTAGAAAATGAAATTCACTATTTGCAAGAGAACCTAAAAAGTATGGAAAAAATCCAAGGCCTTACA

GACCTTCAGCTTCAGGAAGCAGATGAAGAGAAGGAAAGAATTCTGGCCCAACTCCAGGAGTTAGAGAAAAAG AAGAAGCGTGAAGATGCCAGATCTCAG

GAACAGTTTCTTGGTTTAGATGAAGAACTGAAGAGTCTGAAGAAAGCGGTGGCTGCTTCTGATAAATTAGCTGCGGCTGAGCTCACCATTGCCAAAGACC

AGCTCAAGTCCCTGCACGGAACTGTTGTGAGAATTAATCAGGAGCGAGCAGAGGTCGGTACCCAAGTCAGTCAGGATGTGCTCATCAGCACTGTCTCAGA

GTGA
Translation
        MFATETYIVSDAQAVQIRKMVPEGGQLRHEHTPPRVQAPPDLQLEDTEKKISAA AQTRLSELHHEIETAEQKVLRATQEFKQLEEAIQQKK

 ISEAEKDLLLKQLSGRLQHLNRLRQEALDLEIQMEKQRKEIAEKHEEINTVQLATDSLDPKDPKH SHMKAQKRGKEQQLDIMNRQYTQLESRLDEILC

RIAKETEEIKDLEQQLTDG GQIAANEALKKDLEGVISGLQEYLGTIKGQATQAQNECRKLQDEKETLLQRLTEVQQEKEELELIAMDAENMRK ELAEL

ESALQEQHEVNASLQQAQGDLSAYETELETQLKLKDAETSQLKQELEKLLRRTQ LEQSVLQTELEKERESLRDALGKAQSSEEKQQENNELRTQLKQLQ

 - UNI8510 - DDNSLLKKQLKEFQNHLNHVVDGLIHPEEVAARVDELRKRLKLGAGEMR RIHSPSDVLGKSLADLQKQFSEILARSQWEKEEAQVR

ERKLHEEMALQQEKLANGQEEFRQACERALEAR IKFDKRQHNARIQQLENEIHYLQENLKSMEKIQGLTDLQLQEADEEKERILAQLQELEKK KKRED

ARSQEQFLGLDEELKSLKKAVAASDKLAAAELTIAKDQLKSLHGTVVRINQERAEVGTQVSQDVLISTVSE
Transcript ENSMUST00000028235
Sequence
GCCCACACCAAGCTGGCCCTCTCGGCAACCGGCACAACACAACAAAATGGCTGCTGTGCTGTCGGTCTCCTGAGGGGAAGTATCCCGGCGTCTCCGCCTC

GCCCCTCCCGCTAGGCCGTTCCTTCCCGTGCTGAGGCG GTTTTGATGGCCACCTGGTTTTATTCTTGCAATGAAGAAAGGTTCTGAACGAAGGCTCTCC

AAAGCAAAGATGCCGCTGTCATCTCATTTTCCTGGGCCATCATCTCTTAGGTCCAGCATGCGATCTAGGTCCCTTTCACCTTTAATTGGATCTGAGACTC

AGCCTTTACATCCTGGCGGACAGTGGCCTGCACAGGCTGAGCTGACAGATGAAAGCACTGTGCCTTTGGAGCCCCAGCAACGTAAAG GAGCTGAGTCAT

ATGTAGGAGTCCGGTATATTACAGAAGCCCTCATCAAAAAACTCACTAAACAGGACAATTTGGCCTTGGTGAAGTCTCTGAATCTTTCACTTTCTAAAGA

TGGCGGCAAGAAATTTAGG TACATCGAAAATTTGGAAAAGTGTGTTAAACTTGAAGTACTAAATCTCAGCTATAATCTAATAGTGAAGATAGAGAAAGT

GGACAAGCTGTTACGATTACGTGAACTCAACTTATCATATAACAAAATCAG CAAAATTGAAGGACTAGAAAACATGTGTAACCTGCAGAAGCTAAACCT

AGCAGGTAATGAAATCGAGCATATTCCAGTGTGGTTCGCAAAGAAATTGAAATCTTTACGAGTCCTCAATCTGAAAGGCAATAAGATATCATCG CTCCA

GGATGTAAGCAAGTTGAAGCCACTTCAAGATTTGACTTCTTTAGTCCTCATTGACAATCCAGTTGTGGCCCTTCCGCATTACCTCCAGTTCATCATTTTC

CACCTCCGTTCCCTGGAAAGTTTGGAAGGTCAGCCAGTAACCACTCAGGATAGACAAGAGGCTTTCGAGAGATTCAGCTTGG AGGAGATAGAAAGACTG

GAAAAAGACCTGGAGAAGAAGACAGTGGAAACAGAAGAGCTTAAGAACAAGCAAACAAAGTTTCTCGAGGAAATAAAGAATCAGGATAAACTAAACAAGT

CATTAAAAGAAGAAGCCATGTTACAAAAACAGAGCTGTGAGGAGCTAGAAAGTGACCTCAGCACAAAGAAGGAGTTG CTAAAACAGAAAACAGTGGAAC

TAACACGGGCATGTCAGAAGCAGTATGAGCTGGAGCAGGAACTGGCCTTTTATAAAATTGATGCCAAGTTTGAGCCATTAAATTATTATCCATCAGAG T

ATGCTGAAATTGACAAATACCCAGATGAAAGCCCTTACATTGGCAAATCCAGATACAAGAGAAATATGTTTGCCACGGAGACTTACATTGTCAGCGACGC

CCAGGCAGTTCAGATCAGGAAGATGGTGCCAGAAGGAGGACAGCTTAGACACGAGCACACACCCCCGAGAGTCCAAGCACCACCTGATCTACAGTTGGAA

GATACGGAAAAAAAAATAAGTGCAG CACAAACTCGACTGTCAGAACTACACCATGAAATAGAAACAGCAGAACAAAAAGTATTACGGGCTACTCAAGAA

TTTAAACAACTGGAAGAAGCTATACAACAAAAAAAG ATTTCAGAAGCAGAGAAAGACCTCCTTCTCAAGCAGTTGAGTGGTAGACTACAACATCTAAAC

AGATTACGCCAGGAAGCTCTGGACCTAGAAATACAGATGGAAAAGCAAAGAAAAGAAATTGCCGAAAAGCATGAAGAGATCAATACCGTGCAGCTAGCCA

CAGACAGCCTGGATCCCAAAGACCCAAAACATGTAAGTAAAATGGGAAATCTTGACTAGTTCCACGGTCTCCGTGGAACTGCTACTTTATATCTGTGTAT

AGATAGTATTTGCCTTACCATTTTAATAGCAGAATCCTTTCTGAAAGTTTTCATTTGCTATACAGATTTAAGTTAGAAAAAAAAATATTATTCATATACA

AATAATTATATTTTATTATTTATATTTATTAATTATATATGTAAATTATTTGTATATGAATAAATATAATTAGATAGAAAGATATGAATGTATTCATATC

AAACATTTATATCCAAAATGGAACCACCTAGTCTTGAACAAATTGGTTTTCAATAAATGAAGGCTACATGACACACTGGGGTTAGTGGCTGATTTTTGTA

GTATTCTAGAGCAAGAGAAACTTTCTTCAAGGTGCTCTGTAAATTGGTCTCCTAAAGACAGGAAGTGCTGAAGCAAGGTCAGAGGACTTCTGTACCTCTT

TAAGTTTTCATGCAGATAATCCACAAACGTTGTTTGCTGGTTCTATTTATTTTGTCCTTAAAAAGAAAACATTTCTCTAGAGTTTGCCATGATGTGTTGT

GAAATAAAGATGAGTGAACGATAGGGTTAGACTCTTGTCTCTTTCTGTCAATCTATACCCTAGTTAATCTTACTAATGATGTATATTTTAGCCACTATTT

CCTTTATAATTTACTGTCACAGGTGGAATTGTAAAGTTATAATAAAAAAAATGAAGATCTCTGGAGTAACAGGAATCAGAATGTAATGTGATAAGGACAG

TGCACTAGAAATGCTCTAAGTACTTGTCAGATTTCTCTTTTAACATCAGTTTTATATGTTTGTATGTATGTACCTATAAATAGAGGCCATGTAATTTTGA

CAAGGATAAACTAATTGTTGTAGGTATAAA
Translation
 MKKGSERRLSKAKMPLSSHFPGPSSLRSSMRSRSLSPLIGSETQPLHPGGQWPAQAELTDESTVPLEPQQRKG GAESYVGVRYITEALIKKLTKQDNL

ALVKSLNLSLSKDGGKKFR YIENLEKCVKLEVLNLSYNLIVKIEKVDKLLRLRELNLSYNKIS SKIEGLENMCNLQKLNLAGNEIEHIPVWFAKKLKS

LRVLNLKGNKISS LQDVSKLKPLQDLTSLVLIDNPVVALPHYLQFIIFHLRSLESLEGQPVTTQDRQEAFERFSLE EEIERLEKDLEKKTVETEELKN

KQTKFLEEIKNQDKLNKSLKEEAMLQKQSCEELESDLSTKKEL LKQKTVELTRACQKQYELEQELAFYKIDAKFEPLNYYPSE YAEIDKYPDESPYIG

KSRYKRNMFATETYIVSDAQAVQIRKMVPEGGQLRHEHTPPRVQAPPDLQLEDTEKKISAA AQTRLSELHHEIETAEQKVLRATQEFKQLEEAIQQKK 

ISEAEKDLLLKQLSGRLQHLNRLRQEALDLEIQMEKQRKEIAEKHEEINTVQLATDSLDPKDPKHVSKMGNLD
Transcript ENSMUST00000028237
Sequence
ATGAAGAAAGGTTCTGAACGAAGGCTCTCCAAAGCAAAGATGCCGCTGTCATCTCATTTTCCTGGGCCATCATCTCTTAGGTCCAGCATGCGATCTAGGT

CCCTTTCACCTTTAATTGGATCTGAGACTCAGCCTTTACATCCTGGCGGACAGTGGCCTGCACAGGCTGAGCTGACAGATGAAAGCACTGTGCCTTTGGA

GCCCCAGCAACGTAAAG GAGCTGAGTCATATGTAGGAGTCCGGTATATTACAGAAGCCCTCATCAAAAAACTCACTAAACAGGACAATTTGGCCTTGGT

GAAGTCTCTGAATCTTTCACTTTCTAAAGATGGCGGCAAGAAATTTAGG TACATCGAAAATTTGGAAAAGTGTGTTAAACTTGAAGTACTAAATCTCAG

CTATAATCTAATAGTGAAGATAGAGAAAGTGGACAAGCTGTTACGATTACGTGAACTCAACTTATCATATAACAAAATCAG CAAAATTGAAGGACTAGA

AAACATGTGTAACCTGCAGAAGCTAAACCTAGCAGGTAATGAAATCGAGCATATTCCAGTGTGGTTCGCAAAGAAATTGAAATCTTTACGAGTCCTCAAT

CTGAAAGGCAATAAGATATCATCG CTCCAGGATGTAAGCAAGTTGAAGCCACTTCAAGATTTGACTTCTTTAGTCCTCATTGACAATCCAGTTGTGGCC

CTTCCGCATTACCTCCAGTTCATCATTTTCCACCTCCGTTCCCTGGAAAGTTTGGAAGGTCAGCCAGTAACCACTCAGGATAGACAAGAGGCTTTCGAGA

GATTCAGCTTGG AGGAGATAGAAAGACTGGAAAAAGACCTGGAGAAGAAGACAGTGGAAACAGAAGAGCTTAAGAACAAGCAAACAAAGTTTCTCGAGG

AAATAAAGAATCAGGATAAACTAAACAAGTCATTAAAAGAAGAAGCCATGTTACAAAAACAGAGCTGTGAGGAGCTAGAAAGTGACCTCAGCACAAAGAA

GGAGTTG CTAAAACAGAAAACAGTGGAACTAACACGGGCATGTCAGAAGCAGTATGAGCTGGAGCAGGAACTGGCCTTTTATAAAATTGATGCCAAGTT

TGAGCCATTAAATTATTATCCATCAGAG TATGCTGAAATTGACAAATACCCAGATGAAAGCCCTTACATTGGCAAATCCAGATACAAGAGAAATATGTT

TGCCACGGAGACTTACATTGTCAGCGACGCCCAGGCAGTTCAGATCAGGAAGATGGTGCCAGAAGGAGGACAGCTTAGACACGAGCACACACCCCCGAGA

GTCCAAGCACCACCTGATCTACAGTTGGAAGATACGGAAAAAAAAATAAGTGCAG CACAAACTCGACTGTCAGAACTACACCATGAAATAGAAACAGCA

GAACAAAAAGTATTACGGGCTACTCAAGAATTTAAACAACTGGAAGAAGCTATACAACAAAAAAAG ATTTCAGAAGCAGAGAAAGACCTCCTTCTCAAG

CAGTTGAGTGGTAGACTACAACATCTAAACAGATTACGCCAGGAAGCTCTGGACCTAGAAATACAGATGGAAAAGCAAAGAAAAGAAATTGCCGAAAAGC

ATGAAGAGATCAATACCGTGCAGCTAGCCACAGACAGCCTGGATCCCAAAGACCCAAAACAT TCCCACATGAAAGCCCAGAAGAGGGGCAAAGAACAGC

AGCTTGACATTATGAACAGACAGTACACACAGCTCGAAAGCCGCCTGGACGAGATACTTTGTAGAATTGCCAAAGAGACTGAAGAGATCAAGGACCTTGA

ACAGCAGCTTACAGATG GCCAGATAGCAGCAAACGAAGCTCTGAAGAAGGATTTAGAAGGTGTCATCAGTGGGTTGCAAGAGTACCTTGGAACCATCAA

AGGCCAGGCAACTCAGGCCCAGAATGAGTGCAGGAAGCTACAGGATGAGAAAGAGACATTGCTGCAGAGACTGACAGAAGTCCAGCAGGAGAAGGAGGAA

CTTGAACTCATTGCCATGGATGCAGAAAATATGAGGAAG GAGCTTGCAGAGCTAGAAAGTGCCCTCCAGGAACAGCATGAGGTGAATGCATCCCTACAG

CAAGCCCAGGGAGATCTCAGCGCCTATGAAACTGAGCTAGAGACTCAGTTAAAACTAAAAGACGCTGAAACCAGCCAGCTCAAGCAAGAGTTGGAAAAAC

TCCTAAGGCGTACTCAG TTAGAGCAATCGGTGCTTCAAACAGAACTGGAGAAGGAGAGAGAATCCCTCAGGGATGCCCTGGGCAAAGCCCAGTCCTCAG

AAGAGAAACAACAGGAGAACAACGAGCTCCGTACACAGCTGAAGCAGCTGCAG - UNI8510 - GATGACAACAGCCTGTTAAAGAAGCAGCTGAAAG

AGTTTCAGAATCACCTTAACCATGTGGTTGATGGTCTGATTCACCCAGAGGAAGTAGCAGCTCGTGTAGACGAGCTAAGGAAAAGGTTGAAACTAGGAGC

TGGGGAAATGAG AATCCATAGTCCTTCAGATGTCTTAGGGAAAAGTCTTGCTGACCTACAGAAACAGTTCAGTGAAATCCTTGCACGATCCCAGTGGGA

AAAAGAGGAAGCCCAAGTTAGAGAGAGGAAGCTCCATGAAGAAATGGCTCTCCAGCAAGAGAAACTGGCGAATGGTCAAGAGGAGTTCAGGCAGGCCTGC

GAAAGAGCACTTGAAGCCAGA ATTAAGTTTGATAAAAGACAACATAATGCAAGAATCCAGCAATTAGAAAATGAAATTCACTATTTGCAAGAGAACCTA

AAAAGTATGGAAAAAATCCAAGGCCTTACAGACCTTCAGCTTCAGGAAGCAGATGAAGAGAAGGAAAGAATTCTGGCCCAACTCCAGGAGTTAGAGAAAA

AG AAGAAGCGTGAAGATGCCAGATCTCAGGAACAGTTTCTTGGTTTAGATGAAGAACTGAAGAGTCTGAAGAAAGCGGTGGCTGCTTCTGATAAATTAG

CTGCGGCTGAGCTCACCATTGCCAAAGACCAGCTCAAGTCCCTGCACGGAACTGTTGTGAGAATTAATCAGGAGCGAGCAGAG GAGCTGCAGGAGGCAG

AGAGGTTCAGCAGAGAGGCCATGCAAGCAGCCAAGGACCTGAGCAGAGCGGAGGCAGAGATCGAGCTCCTGCAGCACCTTCTCAGGGAGAGAGAGGGCCA

G TTCCGAGATGAGATGGAAAATGCAGATTTAGGTGCTAAAGGAGCAAACTCCCAGCTGCTAGAGATTGAGGCGCTGAACGAGGCCATGGCGAAGCAAAG

AGCTGAGATCACGAGACTCCGGGATGTATTAAACCTCACGGGGGCAG GTACAAAAGGAGGCATTGAGAACGTGTTAGAGGAAATCGCTGAGCTCCGGCA

TGCAGTCTCTGCTCAGAACGAGTACATCAGCAGCATGGCAGATCCTTTCAGAAGACAAGGCTGGTGGTACTTTATGCCACCAGCACCATCCTCAAAA GT

TTCCAGCCATAGTTCTCAGGCCACCAAGGACTCCGGTTTGGGTCTAAAGTACACAGCCTCAACTCCTCTTAGAAAACCACAGCCTGGACAGCAAGAAGAA

AAGGACAGCAGTGGACCTCTGCCTGCTTCAGGGTACTGGGTCTACTCCCCCATCAGAAGCACGCTGCATAAGTCATTTTCAAAGAGAG AAGATGCAGAC

AGTGGAGGAGATAGCCAGGAAGAAAGTGGACTGGATGACCAGGAGGAACCCCCATTTGTGCCTCCCCCTGGGTACATAATGTATACTGTACTTCCTGATG

GTTCTCCTGTACCCCAGGGAGTGGCCCTGTATGCACCATCGCCTCCATTGCCCAACAGCAGCCATCCTCTGACCCCCGGCACTGTGGTTTATGGGCCACC

TCCTGCTGGGGCCCCCATCATATACGGACCTCCTCCTGCCAACTTCGCTGTTCCCCTTGTCCCCGCGGGTGTGCAGCATTGCAACATCCCAGAGCACCAT

AACCTA GAGAATGAAGTGTCTAGACTAGAAGACATAATGCAGCACTTAAAATCAAAACAGCGGGAAGAGCGGCGGCAGAAAGCATCCACGCAGCATTCT

GAGGAAGAAGTGGATGGGCTGCACCGTGATATTGATGACCTTTTGCAAGAGAAGAAAGAATTAGAACTTGAAGTAGAAGAATTACATAGAACTATTGAGA

GACATCAACAACGAAA GGACTTCATTGATGGACATGTTGAGAATCTTATGACTGAACTAGAAATAGAAAAGTCTCTCAAACATCATGAGGATATCGTAG

ATGAAATTGAGTGCCTAGAGAAAACTCTCCTGAAACGTCGCTCGGAACTCAGGGAAGCTGACCGACTTCTGGCGGAAGCCGAGAATGAGCTTGCATGCAC

CAAGGAGAAG ACAAAGAGTGCTGTTGAAAAATTCACTGATGCCAAGAGAAATTTATTACAAACCGAGTCAGACGCTGAGGCACTAGAAAAGAGAGCCCA

GGAGACTGCACTTAACCTTGTGAAAGCAGAGCAGCAGCTAAG ACTGCTCCAGGCTGATGCAGAGGACTTGGAGCAGCACAAAATCAAACAAGAAGAAAT

CTTGAAAGAAATAAACAAAGTTGTAGCAGCCAAAGATGCCGATTTCCAGTGTCTAAACGAGAAGAAGGAAAAACTGACAGAAGA GCTTCAGAGTCTGCA

GAGAGACATCAAGGCAGCGCAACACAGTGAGGATCACCACCTTCAGGTCCTTAGAGAGTCTGAGACTCTCCTTCAGGCCAAGAGAGCTGAGCTGGAAACA

CTGAAAAGCCAG GTGACAAGCCAGCAGCAGGAGTTGGCTGTCCTGGACTCAGAGTTGGGGCATAGAAGGGAGGAGCTGCTTCTACTCCAGGACAGCCTC

GCCCAGGCAAAAGCTGACCTCCAGGAAGCCCTGACACTGGGGGAGACGGAAGTTGCTGAGAAGTGCAGTCACATTAGG GAAGTAAAATCACTTCTGGAA

GAACTAAGTTTTCAGAAAGGAGAACTGAATGTCCACATCAGTGAAAAGAAGACTCAGCTCGCACTTATACAGCAGGAGATGGAGAAAGAGGAAAAGAATC

TTCAGGTGGTTTTACAGCAGCTGTCGAGACATAAGACTG AACTAAAGAATGTTGCAGACATACTGCAGCTTGAAACCAGCGAGCTCCAAGGTCTGAAGC

TCCAGCATGACCAGAAGGTGGTGGAGCTGGAGAAGGCGCAGGTGGACGTGCTGGAG GAGAAACTAGAGCTGGAGAATTTGCAGCAGGCAACGCAGCAGC

AGAGAAGGGAGCTAGAGCGGCAGAGACAGCTCCTGGAGAGAGACAGGCGGGAGACAGAGCGAGTGAGGGCAGAGAGCCAGGCCCTGCAGTCCTGCGTCGA

ATGTCTGAGTAAAGAAAAGGAGGATCTCCAAGGACAGTGCGAGAGCTGGGAAAAGAAGTCTTCCCACGCCCAAAG AGTTCTAGCAGCCACAGAAGAAAG

CAACAAAATGGAGCAGTCCAACCTTGGGAAGTTGGAACTGAGTGTCAGAAAGCTGCGGCAGGAGCTGGAGCAGCTGAGCCAAGACAAGCTTGCCCTACAC

AGTGAGGTAGCCGAGGTGCAGCAGCAGCTACAAG GTAAACAGGAAGCCATAAACTCTCTGCAGGAGGAACTGGATAGCACCCAAGACCATTTGGACCTA

GCAAAGCAG GACCTGATCCACACCACCAAGTGCCAGAACGAGTTGCTCAATGAGCAGACGCAGCTGCAGGAGGACATCAGCAAATGGATGGCCAGGTTA

GAGAGCTGCCAGAAAGAGACGGAGACAAAGGAACAGCAAGTCCAGCAGCTCCAGGATGAGATCAGAGAGAGCAAGCTCCGGCTGGACCAGCAGGAGATG 

ATGTTTCAAAAACTCCAGAAAGAAAGAGAACGTGAGGAGCAGAAGTTCGAGGCTGGTAAAGTGACGCTGGAGCAGCAGCAGAGGCAGCTGGAGAAGGAGC

TGACGGACCAGAAAAGCAGGCTGAAGCAGCTGCTCACAGACGTGTCGGCAGCTGAAGGACGCCTGGGAACCCTGCAGGAAGAGGAGCGGCGCATTGAGGG

CCTGGAGAGGATGCTGTCCCAGGCCA AACAGCAGCTTTCAGAACGGGAGCAGCAGCTAATGGCCAAGTCAGGTGAGCTGCTGGCCCTGCAGAAAGAGGC

TGACGATATGAGGGCCGACTTCAGCCTCCTGAGGAACCAGTTCTTAACAGAAAGGAAGAAGGCAGAGAAGCAGGTGGCCGGGCTAAAGGAAGCACTGAAG

ATCCAGCGCAGTCAGCTGGAGAAAAACCTCCTG GAGCAGAAGCAGGAGAACAGCTGCATGCAAAAGGAAATGGCTACAATTGAGCTGGTGGCCCAGGAC

AACCACGAGAGGGCCAGGCGCCTCATGAAGGAGCTGAGCCAGATGCAGCAGGAGTACCTGGAACTCAAGAAACAG GTAGCAAACCAGAAAGACTTGGAG

AGGAGGCAGATGGAGGTCAGTGACGCAATGAGGACGCTGAAGTCGGAGGTGAAAGACGAAATCAGAACCAGTCTGAGGAACCTCAACCAGTTCCTTCCAG

AACTTCCAGCAGATCTAGCGTCTATTTTGGAAAGAAATGAAAACTTAAGAGAGTTGGAAAGCTTGAAAGAGAACTTCCCGTTTACCACAAAAGAGAGGAT

TTTTGAAGAAAAATCCAACTTTCCCCAAGTTCACATCATG GATGAACACTGGCGTGGAGAAGCACTCCGTCAAAGGCTGCGCCGCCATGAAGATCAACT

CAAG GCTCAACTTCGACACTGTATGTCTAAGCAAGCAGAAGTATTGATCAAAGGAAAGCAGCAGACAGAGGGCACCCTACACAGTCTGAGGAGACAAGT

TGATGCTTTAGGAGAACTGGTCACTAGTACCTCCACAGACTCAGCATCATCACCCAGTCTGCCTTCCCTTGTGGAGGACTCCCAGCATGGGCATAGTCAG

 AGCTCCTTCCAAGTTCTGCAAGTTCCATTAGAAGAACCAAACAGTTACCGCCACTAAGTTTCCTGCTTGCAG GAAAAGAAGCTCCAGCCAAGGTCAGG

AATACAGCCATGTGTAACCATAAGAGGAAATAGCTACTCTCCTACCTCACTGACATCCTAATGGAATGTCAATCAAGATCCTGTGAAGACTGAAAATGCA

TTGTAGTTTGTACCATTTATACCGAGGTGTCTGTAAATCACATGCACTTGTGGGACTAGATGTGTGTATCTAACATAGGATGTAAGGGGCTATTTTTGAC

TCTCCTCCTCCTCCAATGATGAAATATTTTTTAAAGACAGTGAAACCACATATACTGAGTCCATAACTGGTATGTCTAGTTACCATGGAAAAGAATGTAC

TAAAAGCCCCTAGGCTTAATTAATAAGTTATTATTTTTGATTCTGATCCAAAGTTTATTTTTAATATGAAAATAAAGGTACAGTCAACTTGTGTCTGTC
Translation
MKKGSERRLSKAKMPLSSHFPGPSSLRSSMRSRSLSPLIGSETQPLHPGGQWPAQAELTDESTVPLEPQQRKG GAESYVGVRYITEALIKKLTKQDNLA

LVKSLNLSLSKDGGKKFR YIENLEKCVKLEVLNLSYNLIVKIEKVDKLLRLRELNLSYNKIS SKIEGLENMCNLQKLNLAGNEIEHIPVWFAKKLKSL

RVLNLKGNKISS LQDVSKLKPLQDLTSLVLIDNPVVALPHYLQFIIFHLRSLESLEGQPVTTQDRQEAFERFSLE EEIERLEKDLEKKTVETEELKNK

QTKFLEEIKNQDKLNKSLKEEAMLQKQSCEELESDLSTKKEL LKQKTVELTRACQKQYELEQELAFYKIDAKFEPLNYYPSE YAEIDKYPDESPYIGK

SRYKRNMFATETYIVSDAQAVQIRKMVPEGGQLRHEHTPPRVQAPPDLQLEDTEKKISAA AQTRLSELHHEIETAEQKVLRATQEFKQLEEAIQQKK I

SEAEKDLLLKQLSGRLQHLNRLRQEALDLEIQMEKQRKEIAEKHEEINTVQLATDSLDPKDPKH SHMKAQKRGKEQQLDIMNRQYTQLESRLDEILCRI

AKETEEIKDLEQQLTDG GQIAANEALKKDLEGVISGLQEYLGTIKGQATQAQNECRKLQDEKETLLQRLTEVQQEKEELELIAMDAENMRK ELAELES

ALQEQHEVNASLQQAQGDLSAYETELETQLKLKDAETSQLKQELEKLLRRTQ LEQSVLQTELEKERESLRDALGKAQSSEEKQQENNELRTQLKQLQ -

 UNI8510 - DDNSLLKKQLKEFQNHLNHVVDGLIHPEEVAARVDELRKRLKLGAGEMR RIHSPSDVLGKSLADLQKQFSEILARSQWEKEEAQVRER

KLHEEMALQQEKLANGQEEFRQACERALEAR IKFDKRQHNARIQQLENEIHYLQENLKSMEKIQGLTDLQLQEADEEKERILAQLQELEKK KKREDAR

SQEQFLGLDEELKSLKKAVAASDKLAAAELTIAKDQLKSLHGTVVRINQERAE ELQEAERFSREAMQAAKDLSRAEAEIELLQHLLREREGQ FRDEME

NADLGAKGANSQLLEIEALNEAMAKQRAEITRLRDVLNLTGAG GTKGGIENVLEEIAELRHAVSAQNEYISSMADPFRRQGWWYFMPPAPSSK VSSHS

SQATKDSGLGLKYTASTPLRKPQPGQQEEKDSSGPLPASGYWVYSPIRSTLHKSFSKRE EDADSGGDSQEESGLDDQEEPPFVPPPGYIMYTVLPDGSP

VPQGVALYAPSPPLPNSSHPLTPGTVVYGPPPAGAPIIYGPPPANFAVPLVPAGVQHCNIPEHHNL ENEVSRLEDIMQHLKSKQREERRQKASTQHSEE

EVDGLHRDIDDLLQEKKELELEVEELHRTIERHQQRK KDFIDGHVENLMTELEIEKSLKHHEDIVDEIECLEKTLLKRRSELREADRLLAEAENELACT

KEK TKSAVEKFTDAKRNLLQTESDAEALEKRAQETALNLVKAEQQLR RLLQADAEDLEQHKIKQEEILKEINKVVAAKDADFQCLNEKKEKLTEE EL

QSLQRDIKAAQHSEDHHLQVLRESETLLQAKRAELETLKSQ VTSQQQELAVLDSELGHRREELLLLQDSLAQAKADLQEALTLGETEVAEKCSHIR EV

KSLLEELSFQKGELNVHISEKKTQLALIQQEMEKEEKNLQVVLQQLSRHKTE ELKNVADILQLETSELQGLKLQHDQKVVELEKAQVDVLE EKLELEN

LQQATQQQRRELERQRQLLERDRRETERVRAESQALQSCVECLSKEKEDLQGQCESWEKKSSHAQR RVLAATEESNKMEQSNLGKLELSVRKLRQELEQ

LSQDKLALHSEVAEVQQQLQG GKQEAINSLQEELDSTQDHLDLAKQ DLIHTTKCQNELLNEQTQLQEDISKWMARLESCQKETETKEQQVQQLQDEIR

ESKLRLDQQEM MFQKLQKEREREEQKFEAGKVTLEQQQRQLEKELTDQKSRLKQLLTDVSAAEGRLGTLQEEERRIEGLERMLSQAK KQQLSEREQQL

MAKSGELLALQKEADDMRADFSLLRNQFLTERKKAEKQVAGLKEALKIQRSQLEKNLL EQKQENSCMQKEMATIELVAQDNHERARRLMKELSQMQQEY

LELKKQ VANQKDLERRQMEVSDAMRTLKSEVKDEIRTSLRNLNQFLPELPADLASILERNENLRELESLKENFPFTTKERIFEEKSNFPQVHIM DEHW

RGEALRQRLRRHEDQLK AQLRHCMSKQAEVLIKGKQQTEGTLHSLRRQVDALGELVTSTSTDSASSPSLPSLVEDSQHGHSQ SSFQVLQVPLEEPNSY

RH 

For any suggestions or comments, please send an email to unitrap@crg.es