Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000057182 (Scn3a)
Chromosomal location
Chr 2: 65296320 - 65405684 (-)
Description
sodium channel, voltage-gated, type III, alpha Gene [Source:MGI (curated);Acc:Scn3a-001]
RefSeq_peptide
NP_061202.3 
UniGene
Mm.330256 Mm.395627 
MGI
MGI:98249 
Uniprot/SPTREMBL
A2ASI4 Q3UF73 Q68V26 A2ASI5 Q62204 
Human Ortholog
ENSG00000153253 (SCN3A)
Omim not available
UniTrap UNI14371
Vector Insertion
Chr 2: 65374469 - 65405552
Public Clones FHCRC-GT-S16-2C1 (fhcrc) IST11244D8 (tigm) IST11071G1 (tigm) IST14244F8 (tigm)
IST12137B3 (tigm)
Private Clones OST311239 (lexicon) OST52130 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI34420
Vector Insertion
Chr 2: 65322402 - 65332949
Public Clones IST11909E5 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 57% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI31585
Vector Insertion
Chr 2: 65302771 - 65305084
Public Clones IST11675D10 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 76% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000066432
Sequence
GGGTATCATAGAGTGAATCTCAGAACAGGAAGCGGAGGCATAAGCAGAAAGGATTCTGGAAAGGTCTCTTTGTTTTCATATCCACAGAGAAAGCAAGAAA

AAAAAATTGAATGTAATTTGCAAATCCCTGTGGCCCAAATCTGAAGAACTACTGGGGGTGGCACGTTCCATTCTAACCATCTTGGATGCTGTCCTTTGTT

GAGCTGTGATTCCTAAGGCTCTCCATCAG - UNI14371 - GCAATTCTTATGCAAGAAGCTAAACGTAATTAAATGTGCAGGATGAAAAGATGGCCC

AGGCACTGCTGGTACCCCCGGGACCTGAGAGCTTCCGCCTTTTCACTCGAGAATCTCTTGCTGCTATCGAAAAGCGTGCTGCAGAAGAGAAAGCCAAGAA

ACCCAAGAAAGAACAAGACATTGACGATGAGAACAAGCCAAAGCCAAACAGTGACTTGGAAGCTGGGAAGAACCTTCCATTTATCTATGGAGACATTCCT

CCAGAGATGGTGTCGGAGCCTCTGGAGGACCTGGACCCCTACTACGTCAGTAAGAAA - UNI14371 - ACTTTTGTAGTGTTGAATAAAGGGAAGGC

AATTTTTCGATTCAGTGCCACCTCCGCCTTGTATATTTTAACTCCACTAAACCCCGTTAGGAAAATTGCTATTAAGATTTTGGTACACTCA TTATTCAG

CATGCTTATCATGTGCACTATTTTGACCAACTGTGTATTTATGACATTGAGCAATCCTCCTGACTGGACGAAGAATGTAGA GTACACATTCACTGGGAT

CTATACCTTTGAGTCACTTATAAAGATCTTGGCCAGAGGATTCTGCTTAGAAGATTTCACATTTCTTCGTGACCCATGGAACTGGCTGGATTTCAGTGTC

ATCGTGATGGC ATATGTGACAGAGTTTGTGGACCTGGGCAATGTCTCAGCGCTGAGAACGTTCAGAGTTCTCCGAGCATTGAAAACAATATCAGTCATT

CCAG GTTTAAAGACCATCGTGGGGGCCCTGATCCAGTCGGTGAAGAAGCTGTCTGACGTCATGATACTCACTGTGTTCTGTCTGAGCGTCTTTGCTCTC

ATCGGGCTGCAGCTCTTCATGGGCAACCTGAGGAATAAATGCTTGCAGTGGCCTCCAAGCGATTCTGCTTTTGAGATCAACACTACTTCCTACTTCAATG

GCACAATGGACTCAAATGGGACATTTGTTAATGTAACAATGAGCACATTCAACTGGAAGGACTATATCGCAGATGACA GCCACTTTTATGTTTTGGATG

GACAAAAAGATCCTTTACTTTGTGGAAATGGGTCCGATGCAGG ACAATGTCCAGAAGGGTACATCTGTGTGAAGGCTGGACGAAACCCCAACTACGGTT

ACACGAGCTTTGACACATTTAGCTGGGCCTTCTTATCGCTGTTTCGACTCATGACTCAAGACTACTGGGAGAACCTTTACCAGTTG ACATTACGTGCAG

CTGGGAAAACCTACATGATCTTTTTCGTCCTGGTAATTTTCTTGGGCTCATTTTATTTGGTGAACTTGATCCTGGCTGTGGTGGCCATGGCCTATGAGGA

ACAAAATCAGGCCACACTGGAGGAGGCTGAGCAGAAAGAGGCGGAGTTTCAGCAGATGTTGGAGCAGTTGAAAAAGCAGCAAGAGGAGGCTCAG GCGGT

GGCAGCTGCCTCAGCAGCGTCCAGAGACTTCAGTGGGATAGGAGGGTTAGGAGAACTTCTGGAGAGTTCTTCAGAAGCTTCCAAGTTGAGCTCCAAGAGT

GCCAAGGAGTGGAGGAATCGGAGGAAGAAGAGGAGACAGAGGGAGCACTTGGAGGGAAACCACAGACCCGAAGGAGACAGGTTTCCCAAGTCGGAATCAG

AAGACAGCGTCAAGCGAAGGAGTTTCCTGTTCTCCCTGGATGGGAACCCGCTGAGCGGCGACAAGAAGCTGTGCTCTCCCCATCAG TCTCTCTTGAGTA

TCCGTGGCTCCCTGTTTTCCCCAAGACGCAATAGCAAAACGAGCATTTTCAGCTTCAGAGGTCGGGCGAAGGACGTGGGGTCTGAGAATGACTTTGCGGA

TGATGAACACAGCACCTTTGAAGATAGCGAGAGCAGGAGAGACTCACTGTTTGTGCCGCACAGACCTGGAGAGCGACGCAACAGTAACGTTAGTCAGGCC

AGTATGTCATCCAGGATGGTGCCAGGGCTTCCAGCCAATGGGAAGATGCACAGCACTGTGGATTGCAATGGTGTGGTTTCCTTGGTGGGTGGACCCTCAG

CTCTTACGTCACCTACTGGACAGCTTCCGCCAGAGGTGATAATACATAAACCAGCTACTAGTGACACT GGTACCACCACTGAAACAGAAGTCAGGAAGA

GAAGGCTAAGTTCTTACCAGATCTCGATGGAAATGCTGGAGGATTCCTCTGGGAGACAAAGAGCCATGAGCATAGCCAGTATCCTGACCAACACGATGGA

GG AACTTGAAGAATCTAGACAGAAGTGTCCACCATGCTGGTATAGATTTGCCAATGTGTTTTTGATCTGGGACTGTTGTGATTCATGGTTGAAAGTAAA

GCATCTTGTGAATTTGATTGTGATGGATCCATTTGTTGACCTGGCCATCACCATCTGCATCGTGTTAAACACACTGTTCATGGCCATGGAGCACTACCCG

ATGACGGAGCAGTTCAGCAGTGTGCTGACGGTGGGAAACCTG GTCTTCACCGGGATCTTCACAGCCGAGATGGTCCTGAAAATCATCGCAATGGATCCC

TATTACTATTTCCAAGAGGGCTGGAATATCTTTGATGGAATTATTGTTAGCCTGAGTTTAATGGAGCTTGGCCTGGCAAACGTGGAGGGGCTGTCCGTGC

TTCGGTCCTTCAGACTG CTGCGAGTCTTCAAGTTGGCAAAATCCTGGCCCACACTGAATATGCTCATTAAGATCATCGGCAACTCGGTGGGCGCACTGG

GCAACCTGACCCTGGTGCTGGCCATCATCGTCTTCATTTTTGCCGTGGTCGGCATGCAGCTGTTTGGAAAGAGCTACAAGGAGTGTGTTTGCAAGATCAA

TGAGGACTGCAAGCTCCCGCGCTGGCACATGAACGACTTCTTCCACTCCTTCCTGATAGTGTTCCGCGTGCTGTGTGGGGAGTGGATAGAGACCATGTGG

GACTGCATGGAGGTCGCGGGCCAGACCATGTGCCTTATTGTGTTTATGTTGGTCATGGTGATTGGGAACCTTGTG GTTCTGAACCTCTTCCTGGCCTTA

TTGTTGAGTTCCTTTAGTTCAGACAACCTTGCTGCTACGGACGATGATAACGAAATGAACAACCTCCAGATCGCGGTGGGAAGGATGCAAAAGGGGATTG

ATTATGTGAAAAATAAGATACGGGAGTGCTTCCGAAAAGCGTTTTTTAGAAAGCCGAAAGTGATAGAAATCCACGAAGGGAACAAAATAGACAGCTGCAT

GTCCAATAACACGGGCGTAGTTGAAATAAGCAAAGAGCTTAACTACCTTAAAGACGGTAACGGAACCACCAGTGGCGTGGGTACTGGAAGCAGTGTGGAG

AAATACGTAATTGATGAAAATGACTACATGTCATTCATCAACAACCCCAGCCTCACCGTGACGGTGCCAATTGCCGTGGGAGAGTCTGACTTTGAAAATT

TAAACACGGAAGAGTTTAGCAGTGAGTCAGAACTGGAAGAAAGCAAGGAG - UNI34420 - AAATTAAATGCAACCAGCTCTTCTGAAGGAAGCACA

GTTGACGTTGCTCCGCCCCGAGAAGGTGAACAAGCTGAAATTGAACCTGAGGAGGACCTTAAGCCAGAAGCTTGCTTTACTGAAG - UNI34420 - G

ATGCATTAAAAAATTTCCCTTCTGCCAAGTAAGTACGGAAGAAGGTAAAGGAAAAATCTGGTGGAATCTTAGGAAGACCTGCTATAGCATTGTGGAACAC

AACTGGTTTGAGACGTTCATTGTGTTCATGATTCTCCTCAGTAGTGGTGCTTTG GCCTTTGAAGATATATACATTGAGCAACGGAAGACCATCAAAACC

ATGCTGGAGTATGCTGACAAAGTCTTCACTTACATCTTCATCCTGGAAATGCTCCTCAAATGGGTGGCCTATGGATTTCAAACCTATTTCACCAATGCCT

GGTGCTGGTTGGACTTCTTGATTGTTGAT GTTTCTTTGGTTAGCCTGGTGGCCAACGCTCTTGGCTATTCAGAACTTGGTGCCATCAAATCCCTACGGA

CCCTGAGAGCTCTGAGGCCGCTCCGAGCCTTATCCCGCTTTGAAGGCATGAGG GTGGTTGTGAACGCTCTTGTTGGTGCAATCCCCTCCATCATGAATG

TGCTACTGGTGTGCCTCATCTTCTGGTTAATCTTTAGTATCATGGGTGTGAATCTGTTTGCTGGAAAGTTCTATCACTGTGTTAACATGACAACGGGCAG

CATGTTCGACATGAGTGAAGTCAACAATTTCAGCGACTGTCAGGCTCTTGGCAAGCAAGCCCGATGGAAGAATGTGAAAGTCAACTTTGACAATGTTGGG

GCTGGCTACCTGGCATTGCTGCAAGTG GCCACATTCAAAGGCTGGATGGATATTATGTATGCAGCTGTGGATTCACGGGAC GTCAAACTGCAGCCTGT

ATATGAAGAAAATCTGTACATGTATCTGTACTTTGTCATCTTCATCATCTTTGGGTCGTTCTTCACTCTAAATCTATTCATCGGCGTCATCATAGACAAC

TTCAACCAGCAGAAGAAGAAG - UNI31585 - TTTGGAGGTCAAGACATCTTTATGACAGAAGAGCAGAAAAAGTACTACAATGCAATGAAGAAACT

TGGCTCCAAAAAACCTCAGAAGCCCATCCCTCGACCTGCA - UNI31585 - AACAAATTTCAAGGAATGGTCTTTGACTTTGTAACCAGACAAGTGT

TTGACATCAGCATCATGATCCTCATCTGCCTCAACATGGTGACCATGATGGTGGAAACGGACGACCAGAGCAAATACATGACCCTGGTTTTGTCCCGAAT

CAACCTGGTATTCATCGTCCTCTTCACTGGGGAGTTTCTGCTGAAGCTCATCTCTCTCAGATACTACTACTTCACGATTGGCTGGAACATCTTTGACTTT

GTGGTGGTGATTCTCTCAATTGTAG - UNI31585 - GAATGTTCCTTGCTGAGCTGATAGAGAAGTATTTTGTGTCTCCTACCCTGTTCCGAGTCAT

CCGCCTGGCCAGGATTGGACGAATCCTACGCCTGATCAAAGGCGCCAAGGGGATCCGCACGCTGCTCTTTGCTCTGATGATGTCCCTTCCTGCGCTGTTC

AACATCGGCCTCCTGCTTTTCCTCGTCATGTTCATCTACGCCATCTTTGGGATGTCCAACTTTGCCTATGTTAAAAAAGAGGCTGGAATTGATGACATGT

TCAACTTTGAGACTTTTGGCAACAGCATGATCTGCCTGTTCCAAATCACCACCTCTGCGGGCTGGGATGGACTGTTGGCCCCCATCCTCAACAGTGCACC

TCCTGACTGTGACCCTGATGCAATTCACCCTGGAAGCTCAGTGAAGGGAGACTGTGGGAACCCATCTGTGGGGATTTTCTTTTTTGTCAGCTACATCATC

ATATCCTTCCTGGTTGTGGTGAACATGTACATTGCTGTCATCCTGGAGAACTTCAGCGTTGCCACAGAAGAAAGTGCAGAGCCCCTGAGTGAGGACGACT

TTGAGATGTTCTACGAGGTCTGGGAGAAGTTCGACCCTGACGCCACCCAGTTCATAGAGTTCTGCAAGCTCTCTGACTTTGCAGCTGCCCTGGATCCTCC

CCTCCTCATCGCAAAGCCAAACAAAGTCCAGCTCATTGCCATGGACCTGCCCATGGTGAGTGGAGACCGCATCCACTGCCTGGACATCTTATTTGCTTTT

ACAAAGCGGGTCCTGGGTGAGAGTGGAGAGATGGATGCCCTTCGAATCCAGATGGAAGATCGGTTCATGGCTTCCAATCCCTCCAAGGTCTCTTATGAGC

CCATTACCACCACTCTGAAGCGCAAACAAGAGGAGGTGTCTGCTGCTATCATTCAGCGTAATTACAGATGTTATCTTTTAAAGCAAAGGTTAAAAAACAT

ATCAAATACGTATGACAAAGAGACAATCAAGGGGAGGATTGTCTTGCCTATAAAAGGAGATATGGTTATTGACAAATTAAATGGGAATTCCACCCCAGAA

AAGACAGATGGGAGTTCCTCTACCACCTCTCCTCCTTCCTATGACAGTGTAACAAAACCAGATAAGGAAAAGTTTGAGAAAGACAAACCAGAAAAAGAAA

GCAAAGGGAAAGAGGTCTGAGAGAATCAAAAGTAAAAAAACAAAACAAAAAAAATTTCAAAAATTTAAAAAGGAAACAAAGAAATGTCTTTGTAATCAAT

TGTTTACAGCCTCTGAAGGTAAAGTGTCCGTGTCAACTGGACTCTAAGGAGAGGTCCATGCCAAACTGACTGTTTCAACAAATACTCAAGGTCAGTGCCT

ATACCAGACAGTGACCTCTGTCACTGCCACTCTGTGAGACAGGGTATCAACATTGACAAGAGGTTGCTGCTTCCATTACCAGCTGACACTGCTGAGGGGA

ACTCCATTGTGAAAGTGACCGTCATCACGCCACCAAACACCATTAGTACAACCAACGCTCCTGTTATCTATTTTTAACATTCACATTGCCATATTTTTAC

AAAATCTGCCCCAGTGTATCTTCCTGGTCCCCACTTCATAGTCTGTTCATAATACTATGTCACTATTTTTGTAAATGAAGTTATGTTAAGGGAAAATATA

TATATATATAAATCCCATGTTGCTAAGACCACAAGTTTCTCCAGTAATCATAAAAAAAATATTTTGTCTGAGAGATGAAATTATTGCTCAAAACTAAGGA

AAAGTAAATTCTAATGTTACCACTTTGAAATACTTCCACTTTCTGGATGGTGTTAGCTTACAAGTGTTTTAGTCTGTTATGTTTGTATCTGAGCAGTTAT

GTGCCTGTAAAG
Translation
 - UNI14371 - MAQALLVPPGPESFRLFTRESLAAIEKRAAEEKAKKPKKEQDIDDENKPKPNSDLEAGKNLPFIYGDIPPEMVSEPLEDLDPYYVS

KK - UNI14371 - TFVVLNKGKAIFRFSATSALYILTPLNPVRKIAIKILVHS LFSMLIMCTILTNCVFMTLSNPPDWTKNVE EYTFTGIYTFES

LIKILARGFCLEDFTFLRDPWNWLDFSVIVMA AYVTEFVDLGNVSALRTFRVLRALKTISVIPG GLKTIVGALIQSVKKLSDVMILTVFCLSVFALIG

LQLFMGNLRNKCLQWPPSDSAFEINTTSYFNGTMDSNGTFVNVTMSTFNWKDYIADDS SHFYVLDGQKDPLLCGNGSDAG GQCPEGYICVKAGRNPNY

GYTSFDTFSWAFLSLFRLMTQDYWENLYQL TLRAAGKTYMIFFVLVIFLGSFYLVNLILAVVAMAYEEQNQATLEEAEQKEAEFQQMLEQLKKQQEEAQ

 AVAAASAASRDFSGIGGLGELLESSSEASKLSSKSAKEWRNRRKKRRQREHLEGNHRPEGDRFPKSESEDSVKRRSFLFSLDGNPLSGDKKLCSPHQ S

LLSIRGSLFSPRRNSKTSIFSFRGRAKDVGSENDFADDEHSTFEDSESRRDSLFVPHRPGERRNSNVSQASMSSRMVPGLPANGKMHSTVDCNGVVSLVG

GPSALTSPTGQLPPEVIIHKPATSDT GTTTETEVRKRRLSSYQISMEMLEDSSGRQRAMSIASILTNTMEE ELEESRQKCPPCWYRFANVFLIWDCCD

SWLKVKHLVNLIVMDPFVDLAITICIVLNTLFMAMEHYPMTEQFSSVLTVGNL VFTGIFTAEMVLKIIAMDPYYYFQEGWNIFDGIIVSLSLMELGLAN

VEGLSVLRSFRL LRVFKLAKSWPTLNMLIKIIGNSVGALGNLTLVLAIIVFIFAVVGMQLFGKSYKECVCKINEDCKLPRWHMNDFFHSFLIVFRVLCG

EWIETMWDCMEVAGQTMCLIVFMLVMVIGNLV VLNLFLALLLSSFSSDNLAATDDDNEMNNLQIAVGRMQKGIDYVKNKIRECFRKAFFRKPKVIEIHE

GNKIDSCMSNNTGVVEISKELNYLKDGNGTTSGVGTGSSVEKYVIDENDYMSFINNPSLTVTVPIAVGESDFENLNTEEFSSESELEESKE - UNI344

20 - KLNATSSSEGSTVDVAPPREGEQAEIEPEEDLKPEACFTEG - UNI34420 - GCIKKFPFCQVSTEEGKGKIWWNLRKTCYSIVEHNWFETF

IVFMILLSSGAL AFEDIYIEQRKTIKTMLEYADKVFTYIFILEMLLKWVAYGFQTYFTNAWCWLDFLIVD VSLVSLVANALGYSELGAIKSLRTLRAL

RPLRALSRFEGMR VVVNALVGAIPSIMNVLLVCLIFWLIFSIMGVNLFAGKFYHCVNMTTGSMFDMSEVNNFSDCQALGKQARWKNVKVNFDNVGAGYL

ALLQV ATFKGWMDIMYAAVDSRD VKLQPVYEENLYMYLYFVIFIIFGSFFTLNLFIGVIIDNFNQQKKK - UNI31585 - FGGQDIFMTEEQKKY

YNAMKKLGSKKPQKPIPRPA - UNI31585 - NKFQGMVFDFVTRQVFDISIMILICLNMVTMMVETDDQSKYMTLVLSRINLVFIVLFTGEFLLKLI

SLRYYYFTIGWNIFDFVVVILSIVG - UNI31585 - GMFLAELIEKYFVSPTLFRVIRLARIGRILRLIKGAKGIRTLLFALMMSLPALFNIGLLLF

LVMFIYAIFGMSNFAYVKKEAGIDDMFNFETFGNSMICLFQITTSAGWDGLLAPILNSAPPDCDPDAIHPGSSVKGDCGNPSVGIFFFVSYIIISFLVVV

NMYIAVILENFSVATEESAEPLSEDDFEMFYEVWEKFDPDATQFIEFCKLSDFAAALDPPLLIAKPNKVQLIAMDLPMVSGDRIHCLDILFAFTKRVLGE

SGEMDALRIQMEDRFMASNPSKVSYEPITTTLKRKQEEVSAAIIQRNYRCYLLKQRLKNISNTYDKETIKGRIVLPIKGDMVIDKLNGNSTPEKTDGSSS

TTSPPSYDSVTKPDKEKFEKDKPEKESKGKEV
Transcript ENSMUST00000100069
Sequence
AGTGTTTTGTCGTTTGCGCAATGGCGTGTGTCTGCCAGTAGATGGCAGTAACACGTTGAATGCTGCCAGCTTTTTCTTTTTCTTTCTTTTTTTTTTTTTT

TTTTCCTTCCAGGGCCGTTTTCTGATATATGTTGGGTATCATAGAGTGAATCTCAGAACAGGAAGCGGAGGCATAAGCAGAAAGGATTCTGGAAAGGTCT

CTTTGTTTTCATATCCACAGAGAAAGCAAGAAAAAAAAATTGAATGTAATTTGCAAATCCCTGTGGCCCAAATCTGAAGAACTACTGGGGGTGGCACGTT

CCATTCTAACCATCTTGGATGCTGTCCTTTGTTGAGCTGTGATTCCTAAGGCTCTCCATCAG - UNI14371 - GCAATTCTTATGCAAGAAGCTAAA

CGTAATTAAATGTGCAGGATGAAAAGATGGCCCAGGCACTGCTGGTACCCCCGGGACCTGAGAGCTTCCGCCTTTTCACTCGAGAATCTCTTGCTGCTAT

CGAAAAGCGTGCTGCAGAAGAGAAAGCCAAGAAACCCAAGAAAGAACAAGACATTGACGATGAGAACAAGCCAAAGCCAAACAGTGACTTGGAAGCTGGG

AAGAACCTTCCATTTATCTATGGAGACATTCCTCCAGAGATGGTGTCGGAGCCTCTGGAGGACCTGGACCCCTACTACGTCAGTAAGAAA - UNI1437

1 - ACTTTTGTAGTGTTGAATAAAGGGAAGGCAATTTTTCGATTCAGTGCCACCTCCGCCTTGTATATTTTAACTCCACTAAACCCCGTTAGGAAAATT

GCTATTAAGATTTTGGTACACTC TTTATTCAGCATGCTTATCATGTGCACTATTTTGACCAACTGTGTATTTATGACATTGAGCAATCCTCCTGACTGG

ACGAAGAATGTAGA GTACACATTCACTGGGATCTATACCTTTGAGTCACTTATAAAGATCTTGGCCAGAGGATTCTGCTTAGAAGATTTCACATTTCTT

CGTGACCCATGGAACTGGCTGGATTTCAGTGTCATCGTGATGGC ATATGTGACAGAGTTTGTGGACCTGGGCAATGTCTCAGCGCTGAGAACGTTCAGA

GTTCTCCGAGCATTGAAAACAATATCAGTCATTCCAG GTTTAAAGACCATCGTGGGGGCCCTGATCCAGTCGGTGAAGAAGCTGTCTGACGTCATGATA

CTCACTGTGTTCTGTCTGAGCGTCTTTGCTCTCATCGGGCTGCAGCTCTTCATGGGCAACCTGAGGAATAAATGCTTGCAGTGGCCTCCAAGCGATTCTG

CTTTTGAGATCAACACTACTTCCTACTTCAATGGCACAATGGACTCAAATGGGACATTTGTTAATGTAACAATGAGCACATTCAACTGGAAGGACTATAT

CGCAGATGACA GCCACTTTTATGTTTTGGATGGACAAAAAGATCCTTTACTTTGTGGAAATGGGTCCGATGCAGG ACAATGTCCAGAAGGGTACATCT

GTGTGAAGGCTGGACGAAACCCCAACTACGGTTACACGAGCTTTGACACATTTAGCTGGGCCTTCTTATCGCTGTTTCGACTCATGACTCAAGACTACTG

GGAGAACCTTTACCAGTTG ACATTACGTGCAGCTGGGAAAACCTACATGATCTTTTTCGTCCTGGTAATTTTCTTGGGCTCATTTTATTTGGTGAACTT

GATCCTGGCTGTGGTGGCCATGGCCTATGAGGAACAAAATCAGGCCACACTGGAGGAGGCTGAGCAGAAAGAGGCGGAGTTTCAGCAGATGTTGGAGCAG

TTGAAAAAGCAGCAAGAGGAGGCTCAG GCGGTGGCAGCTGCCTCAGCAGCGTCCAGAGACTTCAGTGGGATAGGAGGGTTAGGAGAACTTCTGGAGAGT

TCTTCAGAAGCTTCCAAGTTGAGCTCCAAGAGTGCCAAGGAGTGGAGGAATCGGAGGAAGAAGAGGAGACAGAGGGAGCACTTGGAGGGAAACCACAGAC

CCGAAGGAGACAGGTTTCCCAAGTCGGAATCAGAAGACAGCGTCAAGCGAAGGAGTTTCCTGTTCTCCCTGGATGGGAACCCGCTGAGCGGCGACAAGAA

GCTGTGCTCTCCCCATCAG TCTCTCTTGAGTATCCGTGGCTCCCTGTTTTCCCCAAGACGCAATAGCAAAACGAGCATTTTCAGCTTCAGAGGTCGGGC

GAAGGACGTGGGGTCTGAGAATGACTTTGCGGATGATGAACACAGCACCTTTGAAGATAGCGAGAGCAGGAGAGACTCACTGTTTGTGCCGCACAGACCT

GGAGAGCGACGCAACAGTAAC GGTACCACCACTGAAACAGAAGTCAGGAAGAGAAGGCTAAGTTCTTACCAGATCTCGATGGAAATGCTGGAGGATTCC

TCTGGGAGACAAAGAGCCATGAGCATAGCCAGTATCCTGACCAACACGATGGAGG AACTTGAAGAATCTAGACAGAAGTGTCCACCATGCTGGTATAGA

TTTGCCAATGTGTTTTTGATCTGGGACTGTTGTGATTCATGGTTGAAAGTAAAGCATCTTGTGAATTTGATTGTGATGGATCCATTTGTTGACCTGGCCA

TCACCATCTGCATCGTGTTAAACACACTGTTCATGGCCATGGAGCACTACCCGATGACGGAGCAGTTCAGCAGTGTGCTGACGGTGGGAAACCTG GTCT

TCACCGGGATCTTCACAGCCGAGATGGTCCTGAAAATCATCGCAATGGATCCCTATTACTATTTCCAAGAGGGCTGGAATATCTTTGATGGAATTATTGT

TAGCCTGAGTTTAATGGAGCTTGGCCTGGCAAACGTGGAGGGGCTGTCCGTGCTTCGGTCCTTCAGACTG CTGCGAGTCTTCAAGTTGGCAAAATCCTG

GCCCACACTGAATATGCTCATTAAGATCATCGGCAACTCGGTGGGCGCACTGGGCAACCTGACCCTGGTGCTGGCCATCATCGTCTTCATTTTTGCCGTG

GTCGGCATGCAGCTGTTTGGAAAGAGCTACAAGGAGTGTGTTTGCAAGATCAATGAGGACTGCAAGCTCCCGCGCTGGCACATGAACGACTTCTTCCACT

CCTTCCTGATAGTGTTCCGCGTGCTGTGTGGGGAGTGGATAGAGACCATGTGGGACTGCATGGAGGTCGCGGGCCAGACCATGTGCCTTATTGTGTTTAT

GTTGGTCATGGTGATTGGGAACCTTGTG GTTCTGAACCTCTTCCTGGCCTTATTGTTGAGTTCCTTTAGTTCAGACAACCTTGCTGCTACGGACGATGA

TAACGAAATGAACAACCTCCAGATCGCGGTGGGAAGGATGCAAAAGGGGATTGATTATGTGAAAAATAAGATACGGGAGTGCTTCCGAAAAGCGTTTTTT

AGAAAGCCGAAAGTGATAGAAATCCACGAAGGGAACAAAATAGACAGCTGCATGTCCAATAACACGGGCGTAGTTGAAATAAGCAAAGAGCTTAACTACC

TTAAAGACGGTAACGGAACCACCAGTGGCGTGGGTACTGGAAGCAGTGTGGAGAAATACGTAATTGATGAAAATGACTACATGTCATTCATCAACAACCC

CAGCCTCACCGTGACGGTGCCAATTGCCGTGGGAGAGTCTGACTTTGAAAATTTAAACACGGAAGAGTTTAGCAGTGAGTCAGAACTGGAAGAAAGCAAG

GAG - UNI34420 - AAATTAAATGCAACCAGCTCTTCTGAAGGAAGCACAGTTGACGTTGCTCCGCCCCGAGAAGGTGAACAAGCTGAAATTGAACC

TGAGGAGGACCTTAAGCCAGAAGCTTGCTTTACTGAAG - UNI34420 - GATGCATTAAAAAATTTCCCTTCTGCCAAGTAAGTACGGAAGAAGGTA

AAGGAAAAATCTGGTGGAATCTTAGGAAGACCTGCTATAGCATTGTGGAACACAACTGGTTTGAGACGTTCATTGTGTTCATGATTCTCCTCAGTAGTGG

TGCTTTG GCCTTTGAAGATATATACATTGAGCAACGGAAGACCATCAAAACCATGCTGGAGTATGCTGACAAAGTCTTCACTTACATCTTCATCCTGGA

AATGCTCCTCAAATGGGTGGCCTATGGATTTCAAACCTATTTCACCAATGCCTGGTGCTGGTTGGACTTCTTGATTGTTGAT GTTTCTTTGGTTAGCCT

GGTGGCCAACGCTCTTGGCTATTCAGAACTTGGTGCCATCAAATCCCTACGGACCCTGAGAGCTCTGAGGCCGCTCCGAGCCTTATCCCGCTTTGAAGGC

ATGAGG GTGGTTGTGAACGCTCTTGTTGGTGCAATCCCCTCCATCATGAATGTGCTACTGGTGTGCCTCATCTTCTGGTTAATCTTTAGTATCATGGGT

GTGAATCTGTTTGCTGGAAAGTTCTATCACTGTGTTAACATGACAACGGGCAGCATGTTCGACATGAGTGAAGTCAACAATTTCAGCGACTGTCAGGCTC

TTGGCAAGCAAGCCCGATGGAAGAATGTGAAAGTCAACTTTGACAATGTTGGGGCTGGCTACCTGGCATTGCTGCAAGTG GCCACATTCAAAGGCTGGA

TGGATATTATGTATGCAGCTGTGGATTCACGGGAC GTCAAACTGCAGCCTGTATATGAAGAAAATCTGTACATGTATCTGTACTTTGTCATCTTCATCA

TCTTTGGGTCGTTCTTCACTCTAAATCTATTCATCGGCGTCATCATAGACAACTTCAACCAGCAGAAGAAGAAG - UNI31585 - TTTGGAGGTCAA

GACATCTTTATGACAGAAGAGCAGAAAAAGTACTACAATGCAATGAAGAAACTTGGCTCCAAAAAACCTCAGAAGCCCATCCCTCGACCTGCA - UNI3

1585 - AACAAATTTCAAGGAATGGTCTTTGACTTTGTAACCAGACAAGTGTTTGACATCAGCATCATGATCCTCATCTGCCTCAACATGGTGACCATG

ATGGTGGAAACGGACGACCAGAGCAAATACATGACCCTGGTTTTGTCCCGAATCAACCTGGTATTCATCGTCCTCTTCACTGGGGAGTTTCTGCTGAAGC

TCATCTCTCTCAGATACTACTACTTCACGATTGGCTGGAACATCTTTGACTTTGTGGTGGTGATTCTCTCAATTGTAG - UNI31585 - GAATGTTC

CTTGCTGAGCTGATAGAGAAGTATTTTGTGTCTCCTACCCTGTTCCGAGTCATCCGCCTGGCCAGGATTGGACGAATCCTACGCCTGATCAAAGGCGCCA

AGGGGATCCGCACGCTGCTCTTTGCTCTGATGATGTCCCTTCCTGCGCTGTTCAACATCGGCCTCCTGCTTTTCCTCGTCATGTTCATCTACGCCATCTT

TGGGATGTCCAACTTTGCCTATGTTAAAAAAGAGGCTGGAATTGATGACATGTTCAACTTTGAGACTTTTGGCAACAGCATGATCTGCCTGTTCCAAATC

ACCACCTCTGCGGGCTGGGATGGACTGTTGGCCCCCATCCTCAACAGTGCACCTCCTGACTGTGACCCTGATGCAATTCACCCTGGAAGCTCAGTGAAGG

GAGACTGTGGGAACCCATCTGTGGGGATTTTCTTTTTTGTCAGCTACATCATCATATCCTTCCTGGTTGTGGTGAACATGTACATTGCTGTCATCCTGGA

GAACTTCAGCGTTGCCACAGAAGAAAGTGCAGAGCCCCTGAGTGAGGACGACTTTGAGATGTTCTACGAGGTCTGGGAGAAGTTCGACCCTGACGCCACC

CAGTTCATAGAGTTCTGCAAGCTCTCTGACTTTGCAGCTGCCCTGGATCCTCCCCTCCTCATCGCAAAGCCAAACAAAGTCCAGCTCATTGCCATGGACC

TGCCCATGGTGAGTGGAGACCGCATCCACTGCCTGGACATCTTATTTGCTTTTACAAAGCGGGTCCTGGGTGAGAGTGGAGAGATGGATGCCCTTCGAAT

CCAGATGGAAGATCGGTTCATGGCTTCCAATCCCTCCAAGGTCTCTTATGAGCCCATTACCACCACTCTGAAGCGCAAACAAGAGGAGGTGTCTGCTGCT

ATCATTCAGCGTAATTACAGATGTTATCTTTTAAAGCAAAGGTTAAAAAACATATCAAATACGTATGACAAAGAGACAATCAAGGGGAGGATTGTCTTGC

CTATAAAAGGAGATATGGTTATTGACAAATTAAATGGGAATTCCACCCCAGAAAAGACAGATGGGAGTTCCTCTACCACCTCTCCTCCTTCCTATGACAG

TGTAACAAAACCAGATAAGGAAAAGTTTGAGAAAGACAAACCAGAAAAAGAAAGCAAAGGGAAAGAGGTCTGAGAGAATCAAAAGTAAAAAAACAAAACA

AAAAAAATTTCAAAAATTTAAAAAGGAAACAAAGAAATGTCTTTGTAATCAATTGTTTACAGCCTCTGAAGGTAAAGTGTCCGTGTCAACTGGACTCTAA

GGAGAGGTCCATGCCAAACTGACTGTTTCAACAAATACTCAAGGTCAGTGCCTATACCAGACAGTGACCTCTGTCACTGCCACTCTGTGAGACAGGGTAT

CAACATTGACAAGAGGTTGCTGCTTCCATTACCAGCTGACACTGCTGAGGGGAACTCCATTGTGAAAGTGACCGTCATCACGCCACCAAACACCATTAGT

ACAACCAACGCTCCTGTTATCTATTTTTAACATTCACATTGCCATATTTTTACAAAATCTGCCCCAGTGTATCTTCCTGGTCCCCACTTCATAGTCTGTT

CATAATACTATGTCACTATTTTTGTAAATGAAGTTATGTTAAGGGAAAATATATATATATATAAATCCCATGTTGCTAAGACCACAAGTTTCTCCAGTAA

TCATAAAAAAAATATTTTGTCTGAGAGATGAAATTATTGCTCAAAACTAAGGAAAAGTAAATTCTAATGTTACCACTTTGAAATACTTCCACTTTCTGGA

TGGTGTTAGCTTACAAGTGTTTTAGTCTGTTATGTTTGTATCTGAGCAGTTATGTGCCTGTAAAGACTCCTCTAATATTTAAAGGATTATTTTTATGCAA

AATATTTTGTTTCAAAAAGTGCAAATTTTATTCTAAGTTTCAGAGTTCTATATTTAATTTTAGTTAAATGTCCTCCCTCAAAAAAAAATTATCTAATATT

TCTGTTCTGAAAAAAAAGAAAATCTATCCAAAGTATCACCTTAGAATACCTGCTCCACTTACTGGGCAGTATTTCTTTGCCATCTTCTGCTCTCAGCAAA

ACTGACAATTTATGTCAGTTAAATACCCTCTGTTATGTAAATAGTTATTTTATCCTGTGGTGCATGTTTGGGCAAATATATATAAACGTATATATAGCCT

AATACACAAATTCTATTAAATCAAATATGTACCACAGTGTGTGTGTGTCCTGAGCAAGCTTCCAACAGGGAGGTGTCCTGTATCATTCGTTACACAGAAA

GAGTTTGGGAGGCTATCACTAATGCATGCTAATATTGCCTACGCTGCTCTATTTTAATCAATCCATTTATCACAGTTTTGGTAAGAAGAGTCACATGTTG

GTGGTAGAATGAATTCAATCTGCTCTCTGTCTACATGTCAAAAAATTCTCACTGATATTACCTTAAAACACCTTTATTTTTACATTGTTAATTCAACTTG

AGTATCATAACGTGTCTTTATTAATTTAAAGGAGACACACTGTATAGGGCCTATTACCAAATCCTATACTTCATAGTTTGCTAAAAAAAGAAAAAAAAGT

CCAAAATTTGTTTAAATATAAATAATGTAAAATATCATCAGTTTTCTTTGTCAACATTTGTACATAAGAAGATTATTTTCGGGTTAATGACATGGCAATT

TATTTTACCTTATCCTGTTGCTTCTTATTTTTAAATCAAAACTCCAAACTTTTGCATCCAAAAGACTTTTCAATAGATAATTTCCTAAAATAAAAGTTAG

ACAATGGGTTTTATGGATTTCTTTGTTATAATATATTTTCTACCATCCTAATAAGAGATACGTTGGTCAAAATCTCAAACCCTAACCATTTTCTACCAAC

TCTGGTTGCCTGCAGAGAATCCTTCACTCATGGAAGTTTGGGTTTTTTTGTTTATTTTTTGGGTTTTTTTTTTTTTAACTCAACTTTTGTAGTATTTGCA

TATGCGGACTAGGCTTATTTTTTTAAATCCTGCTGCACTAAAGGTATCATGGATCTAACACGGGCTCTGTCCTTTCTAACCAGGAACCAAGTGGGAAAGT

TGTGCAATTGCCTAACATGATACAACTCTTTTCTCCTTTCTCTTCTTTTTTTCACAAACCAAAAGTTTAGTGTTCATTCCTTTTACAAAACTCTTCACTG

TAGTATACTGATGAACTGCATGCAGGGAATGGCGAGCTACTTCGTTATTGAGCCAAAAGAATAAATATTTCATTTTTTTTTTACTGTATCTGATTTGTTG

GACTGAGTATTTTCTTTTTTAAGTTATCGGCAGGTAAAAATTTACACAACTAAAGAAAACCTGTATTTGATTCGACATTTGTATTCATAGAAGTTCACAT

GGGTTTTGTAACACCCTGCTACACTATCTACTGAGAAGTTTGTCAAAATAAAGACTAGTTAAAAGCA
Translation
 - UNI14371 - MAQALLVPPGPESFRLFTRESLAAIEKRAAEEKAKKPKKEQDIDDENKPKPNSDLEAGKNLPFIYGDIPPEMVSEPLEDLDPYYVS

KK - UNI14371 - TFVVLNKGKAIFRFSATSALYILTPLNPVRKIAIKILVHS SLFSMLIMCTILTNCVFMTLSNPPDWTKNVE EYTFTGIYTFE

SLIKILARGFCLEDFTFLRDPWNWLDFSVIVMA AYVTEFVDLGNVSALRTFRVLRALKTISVIPG GLKTIVGALIQSVKKLSDVMILTVFCLSVFALI

GLQLFMGNLRNKCLQWPPSDSAFEINTTSYFNGTMDSNGTFVNVTMSTFNWKDYIADDS SHFYVLDGQKDPLLCGNGSDAG GQCPEGYICVKAGRNPN

YGYTSFDTFSWAFLSLFRLMTQDYWENLYQL TLRAAGKTYMIFFVLVIFLGSFYLVNLILAVVAMAYEEQNQATLEEAEQKEAEFQQMLEQLKKQQEEA

Q AVAAASAASRDFSGIGGLGELLESSSEASKLSSKSAKEWRNRRKKRRQREHLEGNHRPEGDRFPKSESEDSVKRRSFLFSLDGNPLSGDKKLCSPHQ 

SLLSIRGSLFSPRRNSKTSIFSFRGRAKDVGSENDFADDEHSTFEDSESRRDSLFVPHRPGERRNSN GTTTETEVRKRRLSSYQISMEMLEDSSGRQRA

MSIASILTNTMEE ELEESRQKCPPCWYRFANVFLIWDCCDSWLKVKHLVNLIVMDPFVDLAITICIVLNTLFMAMEHYPMTEQFSSVLTVGNL VFTGI

FTAEMVLKIIAMDPYYYFQEGWNIFDGIIVSLSLMELGLANVEGLSVLRSFRL LRVFKLAKSWPTLNMLIKIIGNSVGALGNLTLVLAIIVFIFAVVGM

QLFGKSYKECVCKINEDCKLPRWHMNDFFHSFLIVFRVLCGEWIETMWDCMEVAGQTMCLIVFMLVMVIGNLV VLNLFLALLLSSFSSDNLAATDDDNE

MNNLQIAVGRMQKGIDYVKNKIRECFRKAFFRKPKVIEIHEGNKIDSCMSNNTGVVEISKELNYLKDGNGTTSGVGTGSSVEKYVIDENDYMSFINNPSL

TVTVPIAVGESDFENLNTEEFSSESELEESKE - UNI34420 - KLNATSSSEGSTVDVAPPREGEQAEIEPEEDLKPEACFTEG - UNI34420 -

 GCIKKFPFCQVSTEEGKGKIWWNLRKTCYSIVEHNWFETFIVFMILLSSGAL AFEDIYIEQRKTIKTMLEYADKVFTYIFILEMLLKWVAYGFQTYFT

NAWCWLDFLIVD VSLVSLVANALGYSELGAIKSLRTLRALRPLRALSRFEGMR VVVNALVGAIPSIMNVLLVCLIFWLIFSIMGVNLFAGKFYHCVNM

TTGSMFDMSEVNNFSDCQALGKQARWKNVKVNFDNVGAGYLALLQV ATFKGWMDIMYAAVDSRD VKLQPVYEENLYMYLYFVIFIIFGSFFTLNLFIG

VIIDNFNQQKKK - UNI31585 - FGGQDIFMTEEQKKYYNAMKKLGSKKPQKPIPRPA - UNI31585 - NKFQGMVFDFVTRQVFDISIMILIC

LNMVTMMVETDDQSKYMTLVLSRINLVFIVLFTGEFLLKLISLRYYYFTIGWNIFDFVVVILSIVG - UNI31585 - GMFLAELIEKYFVSPTLFRV

IRLARIGRILRLIKGAKGIRTLLFALMMSLPALFNIGLLLFLVMFIYAIFGMSNFAYVKKEAGIDDMFNFETFGNSMICLFQITTSAGWDGLLAPILNSA

PPDCDPDAIHPGSSVKGDCGNPSVGIFFFVSYIIISFLVVVNMYIAVILENFSVATEESAEPLSEDDFEMFYEVWEKFDPDATQFIEFCKLSDFAAALDP

PLLIAKPNKVQLIAMDLPMVSGDRIHCLDILFAFTKRVLGESGEMDALRIQMEDRFMASNPSKVSYEPITTTLKRKQEEVSAAIIQRNYRCYLLKQRLKN

ISNTYDKETIKGRIVLPIKGDMVIDKLNGNSTPEKTDGSSSTTSPPSYDSVTKPDKEKFEKDKPEKESKGKEV
Transcript ENSMUST00000045256
Sequence
GGGTATCATAGAGTGAATCTCAGAACAGGAAGCGGAGGCATAAGCAGAAAGGATTCTGGAAAGGTCTCTTTGTTTTCATATCCACAGAGAAAGCAAGAAA

AAAAAATTGAATGTAATTTGCAAATCCCTGTGGCCCAAATCTGAAGAACTACTGGGGGTGGCACGTTCCATTCTAACCATCTTGGATGCTGTCCTTTGTT

GAGCTGTGATTCCTAAGGCTCTCCATCAG - UNI14371 - GCAATTCTTATGCAAGAAGCTAAACGTAATTAAATGTGCAGGATGAAAAGATGGCCC

AGGCACTGCTGGTACCCCCGGGACCTGAGAGCTTCCGCCTTTTCACTCGAGAATCTCTTGCTGCTATCGAAAAGCGTGCTGCAGAAGAGAAAGCCAAGAA

ACCCAAGAAAGAACAAGACATTGACGATGAGAACAAGCCAAAGCCAAACAGTGACTTGGAAGCTGGGAAGAACCTTCCATTTATCTATGGAGACATTCCT

CCAGAGATGGTGTCGGAGCCTCTGGAGGACCTGGACCCCTACTACGTCAGTAAGAAA - UNI14371 - ACTTTTGTAGTGTTGAATAAAGGGAAGGC

AATTTTTCGATTCAGTGCCACCTCCGCCTTGTATATTTTAACTCCACTAAACCCCGTTAGGAAAATTGCTATTAAGATTTTGGTACACTC TTTATTCAG

CATGCTTATCATGTGCACTATTTTGACCAACTGTGTATTTATGACATTGAGCAATCCTCCTGACTGGACGAAGAATGTAGA GTACACATTCACTGGGAT

CTATACCTTTGAGTCACTTATAAAGATCTTGGCCAGAGGATTCTGCTTAGAAGATTTCACATTTCTTCGTGACCCATGGAACTGGCTGGATTTCAGTGTC

ATCGTGATGGC ATATGTGACAGAGTTTGTGGACCTGGGCAATGTCTCAGCGCTGAGAACGTTCAGAGTTCTCCGAGCATTGAAAACAATATCAGTCATT

CCAG GTTTAAAGACCATCGTGGGGGCCCTGATCCAGTCGGTGAAGAAGCTGTCTGACGTCATGATACTCACTGTGTTCTGTCTGAGCGTCTTTGCTCTC

ATCGGGCTGCAGCTCTTCATGGGCAACCTGAGGAATAAATGCTTGCAGTGGCCTCCAAGCGATTCTGCTTTTGAGATCAACACTACTTCCTACTTCAATG

GCACAATGGACTCAAATGGGACATTTGTTAATGTAACAATGAGCACATTCAACTGGAAGGACTATATCGCAGATGACA GCCACTTTTATGTTTTGGATG

GACAAAAAGATCCTTTACTTTGTGGAAATGGGTCCGATGCAGG ACAATGTCCAGAAGGGTACATCTGTGTGAAGGCTGGACGAAACCCCAACTACGGTT

ACACGAGCTTTGACACATTTAGCTGGGCCTTCTTATCGCTGTTTCGACTCATGACTCAAGACTACTGGGAGAACCTTTACCAGTTG ACATTACGTGCAG

CTGGGAAAACCTACATGATCTTTTTCGTCCTGGTAATTTTCTTGGGCTCATTTTATTTGGTGAACTTGATCCTGGCTGTGGTGGCCATGGCCTATGAGGA

ACAAAATCAGGCCACACTGGAGGAGGCTGAGCAGAAAGAGGCGGAGTTTCAGCAGATGTTGGAGCAGTTGAAAAAGCAGCAAGAGGAGGCTCAG GCGGT

GGCAGCTGCCTCAGCAGCGTCCAGAGACTTCAGTGGGATAGGAGGGTTAGGAGAACTTCTGGAGAGTTCTTCAGAAGCTTCCAAGTTGAGCTCCAAGAGT

GCCAAGGAGTGGAGGAATCGGAGGAAGAAGAGGAGACAGAGGGAGCACTTGGAGGGAAACCACAGACCCGAAGGAGACAGGTTTCCCAAGTCGGAATCAG

AAGACAGCGTCAAGCGAAGGAGTTTCCTGTTCTCCCTGGATGGGAACCCGCTGAGCGGCGACAAGAAGCTGTGCTCTCCCCATCAG TCTCTCTTGAGTA

TCCGTGGCTCCCTGTTTTCCCCAAGACGCAATAGCAAAACGAGCATTTTCAGCTTCAGAGGTCGGGCGAAGGACGTGGGGTCTGAGAATGACTTTGCGGA

TGATGAACACAGCACCTTTGAAGATAGCGAGAGCAGGAGAGACTCACTGTTTGTGCCGCACAGACCTGGAGAGCGACGCAACAGTAACGTTAGTCAGGCC

AGTATGTCATCCAGGATGGTGCCAGGGCTTCCAGCCAATGGGAAGATGCACAGCACTGTGGATTGCAATGGTGTGGTTTCCTTGGTGGGTGGACCCTCAG

CTCTTACGTCACCTACTGGACAGCTTCCGCCAGAGGTGATAATACATAAACCAGCTACTAGTGAC CAGGGTACCACCACTGAAACAGAAGTCAGGAAGA

GAAGGCTAAGTTCTTACCAGATCTCGATGGAAATGCTGGAGGATTCCTCTGGGAGACAAAGAGCCATGAGCATAGCCAGTATCCTGACCAACACGATGGA

GG AACTTGAAGAATCTAGACAGAAGTGTCCACCATGCTGGTATAGATTTGCCAATGTGTTTTTGATCTGGGACTGTTGTGATTCATGGTTGAAAGTAAA

GCATCTTGTGAATTTGATTGTGATGGATCCATTTGTTGACCTGGCCATCACCATCTGCATCGTGTTAAACACACTGTTCATGGCCATGGAGCACTACCCG

ATGACGGAGCAGTTCAGCAGTGTGCTGACGGTGGGAAACCTG GTCTTCACCGGGATCTTCACAGCCGAGATGGTCCTGAAAATCATCGCAATGGATCCC

TATTACTATTTCCAAGAGGGCTGGAATATCTTTGATGGAATTATTGTTAGCCTGAGTTTAATGGAGCTTGGCCTGGCAAACGTGGAGGGGCTGTCCGTGC

TTCGGTCCTTCAGACTG CTGCGAGTCTTCAAGTTGGCAAAATCCTGGCCCACACTGAATATGCTCATTAAGATCATCGGCAACTCGGTGGGCGCACTGG

GCAACCTGACCCTGGTGCTGGCCATCATCGTCTTCATTTTTGCCGTGGTCGGCATGCAGCTGTTTGGAAAGAGCTACAAGGAGTGTGTTTGCAAGATCAA

TGAGGACTGCAAGCTCCCGCGCTGGCACATGAACGACTTCTTCCACTCCTTCCTGATAGTGTTCCGCGTGCTGTGTGGGGAGTGGATAGAGACCATGTGG

GACTGCATGGAGGTCGCGGGCCAGACCATGTGCCTTATTGTGTTTATGTTGGTCATGGTGATTGGGAACCTTGTG GTTCTGAACCTCTTCCTGGCCTTA

TTGTTGAGTTCCTTTAGTTCAGACAACCTTGCTGCTACGGACGATGATAACGAAATGAACAACCTCCAGATCGCGGTGGGAAGGATGCAAAAGGGGATTG

ATTATGTGAAAAATAAGATACGGGAGTGCTTCCGAAAAGCGTTTTTTAGAAAGCCGAAAGTGATAGAAATCCACGAAGGGAACAAAATAGACAGCTGCAT

GTCCAATAACACGGGCGTAGTTGAAATAAGCAAAGAGCTTAACTACCTTAAAGACGGTAACGGAACCACCAGTGGCGTGGGTACTGGAAGCAGTGTGGAG

AAATACGTAATTGATGAAAATGACTACATGTCATTCATCAACAACCCCAGCCTCACCGTGACGGTGCCAATTGCCGTGGGAGAGTCTGACTTTGAAAATT

TAAACACGGAAGAGTTTAGCAGTGAGTCAGAACTGGAAGAAAGCAAGGAGGTAAGCGTGCTTTTCAGTTCCGGCCACCAC - UNI34420 - TTTTGC

ATTATCTACACAGTATGGCTACTCTGTATTGTTTTTTGCCTGTAG
Translation
 - UNI14371 -  - UNI14371 -              MLIKIIGNSVGALGNLTLVLAIIVFIFAVVGMQLFGKSYKECVCKINEDCKLPRWHMND

FFHSFLIVFRVLCGEWIETMWDCMEVAGQTMCLIVFMLVMVIGNLV VLNLFLALLLSSFSSDNLAATDDDNEMNNLQIAVGRMQKGIDYVKNKIRECFR

KAFFRKPKVIEIHEGNKIDSCMSNNTGVVEISKELNYLKDGNGTTSGVGTGSSVEKYVIDENDYMSFINNPSLTVTVPIAVGESDFENLNTEEFSSESEL

EESKEVSVLFSSGHH - UNI34420 - FCIIYTVWLLCIVFCL
Transcript ENSMUST00000112407
Sequence
AGGTACACATTCACTGGGATCTATACCTTTGAGTCACTTATAAAGATCTTGGCCAGAGGATTCTGCTTAGAAGATTTCACATTTCTTCGTGACCCATGGA

ACTGGCTGGATTTCAGTGTCATCGTGATGGC GTATGTAACAGAATTTGTAAGCCTAGGCAATGTTTCAGCTCTTCGAACTTTCAGAGTCTTGCGAGCTC

TGAAAACTATTTCTGTAATTCCAG GTTTAAAGACCATCGTGGGGGCCCTGATCCAGTCGGTGAAGAAGCTGTCTGACGTCATGATACTCACTGTGTTCT

GTCTGAGCGTCTTTGCTCTCATCGGGCTGCAGCTCTTCATGGGCAACCTGAGGAATAAATGCTTGCAGTGGCCTCCAAGCGATTCTGCTTTTGAGATCAA

CACTACTTCCTACTTCAATGGCACAATGGACTCAAATGGGACATTTGTTAATGTAACAATGAGCACATTCAACTGGAAGGACTATATCGCAGATGACA G

CCACTTTTATGTTTTGGATGGACAAAAAGATCCTTTACTTTGTGGAAATGGGTCCGATGCAGG ACAATGTCCAGAAGGGTACATCTGTGTGAAGGCTGG

ACGAAACCCCAACTACGGTTACACGAGCTTTGACACATTTAGCTGGGCCTTCTTATCGCTGTTTCGACTCATGACTCAAGACTACTGGGAGAACCTTTAC

CAGTTG ACATTACGTGCAGCTGGGAAAACCTACATGATCTTTTTCGTCCTGGTAATTTTCTTGGGCTCATTTTATTTGGTGAACTTGATCCTGGCTGTG

GTGGCCATGGCCTATGAGGAACAAAATCAGGCCACACTGGAGGAGGCTGAGCAGAAAGAGGCGGAGTTTCAGCAGATGTTGGAGCAGTTGAAAAAGCAGC

AAGAGGAGGCTCAG GCGGTGGCAGCTGCCTCAGCAGCGTCCAGAGACTTCAGTGGGATAGGAGGGTTAGGAGAACTTCTGGAGAGTTCTTCAGAAGCTT

CCAAGTTGAGCTCCAAGAGTGCCAAGGAGTGGAGGAATCGGAGGAAGAAGAGGAGACAGAGGGAGCACTTGGAGGGAAACCACAGACCCGAAGGAGACAG

GTTTCCCAAGTCGGAATCAGAAGACAGCGTCAAGCGAAGGAGTTTCCTGTTCTCCCTGGATGGGAACCCGCTGAGCGGCGACAAGAAGCTGTGCTCTCCC

CATCAG TCTCTCTTGAGTATCCGTGGCTCCCTGTTTTCCCCAAGACGCAATAGCAAAACGAGCATTTTCAGCTTCAGAGGTCGGGCGAAGGACGTGGGG

TCTGAGAATGACTTTGCGGATGATGAACACAGCACCTTTGAAGATAGCGAGAGCAGGAGAGACTCACTGTTTGTGCCGCACAGACCTGGAGAGCGACGCA

ACAGTAACGTTAGTCAGGCCAGTATGTCATCCAGGATGGTGCCAGGGCTTCCAGCCAATGGGAAGATGCACAGCACTGTGGATTGCAATGGTGTGGTTTC

CTTGGTGGGTGGACCCTCAGCTCTTACGTCACCTACTGGACAGCTTCCGCCAGAGGTGATAATACATAAACCAGCTACTAGTGACACTTTACT
Translation
RYTFTGIYTFESLIKILARGFCLEDFTFLRDPWNWLDFSVIVMA AYVTEFVSLGNVSALRTFRVLRALKTISVIPG GLKTIVGALIQSVKKLSDVMIL

TVFCLSVFALIGLQLFMGNLR     

For any suggestions or comments, please send an email to unitrap@crg.es