Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000057193 (Slc44a2)
Chromosomal location
Chr 9: 21125265 - 21159469 (+)
Description
solute carrier family 44, member 2 Gene [Source:MGI Symbol;Acc:MGI:1915932]
RefSeq_dna
NM_152808 
RefSeq_peptide
NP_690021.1 
MGI
MGI:1915932 
Uniprot/SWISSPROT
Q8BY89 
Human Ortholog
ENSG00000129353 (SLC44A2)
Omim not available
UniTrap UNI32452
Vector Insertion
Chr 9: 21125296 - 21142287
Public Clones IST14545D3 (tigm) IST14737B3 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI22061
Vector Insertion
Chr 9: 21142934 - 21146222
Public Clones not available
Private Clones OST309944 (lexicon)
Severity of mutation (?) Insertion after 4% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI14365
Vector Insertion
Chr 9: 21146297 - 21146382
Public Clones FHCRC-GT-S16-6H1 (fhcrc)
Private Clones not available
Severity of mutation (?) Insertion after 8% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI10667
Vector Insertion
Chr 9: 21151396 - 21151478
Public Clones G015C03 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 71% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI36121
Vector Insertion
Chr 9: 21153071 - 21156910
Public Clones IST14358F11 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 91% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI22962
Vector Insertion
Chr 9: 21156996 - 21158125
Public Clones CMHD-GT_473C7-3 (cmhd) CMHD-GT_502H7-3 (cmhd) IST14329C8 (tigm) IST12312E4 (tigm)
IST12049G2 (tigm)
Private Clones OST280146 (lexicon)
Severity of mutation (?) Insertion after 95% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000034697
Sequence
GTCCTGGAGCAGCTGCAGCGGGTGGCGGCTGTGTCCAGGAGGGCTCCGACCGTCAAGGCGCCGTCGGGGCTGCACCGCAGGAATGGGGAAGGATTCGCAG

AATTACTACGGGAAGCACG GGACGCCTCAGAAATACGACCCCACCTTCAAAGGACCCATTTACAACAG - UNI22061 - GGGATGCACAGATGTCA

TTTGCTGTGTGTTGCTCTTCCTGGCCATCGTAGGCTATGTGGCTGTGGGCATCATAG - UNI14365 - CCTGGACCCATGGAGACCCTCGGAAGGTG

ATCTACCCCACTGATAGCCGGGGCGAATTCTGTGGGCAAAAGGGGACAAAAAATGC GGACAAACCGTTCTTGTTTTACTTCAACATCGTGAAGTGTGCC

AACCCCCTGGTCCTGCTGGAATTTCACTGTCCCACCCCTCAG ATCTGCGTGAAGCAGTGTCCAGACCGCTATCTCACCCTTCTGAGTGCGCGCAACACT

CGCGACTTTGACTATTACAAGCAGTTCTGTGTGCCTGGCTTCCAGAACAATAAA GGGGTGACTGAGATACTCCGAGATGGGGAGTGTCCAGCGGTTATC

ACCCCCAGCAAACCTT TGGCCCAGCGGTGCTTTCCCGCCATCCATGCCAGCAAAGGAGTCCTCATGGTGGGCAATGAGACGACCTATGAGGACGGACAT

GGCGCCAGAAAGAACATTACAGATCTAGTGGAGGGTGCCAA AAAGGCCAACAAGATTCTAGAGGCCCGGCAACTCGCCATGCAGATATTTGAAGATTAC

ACTGTATCCTGGTACTGGATTATCAT AGGTCTGGTCATTGCCATGGTGCTGAGTCTCCTGTTCATCGTCCTGCTGCGATTCCTGGCTGGCATTATGGTC

TGGGTGATGATTGTCATGGTGATCCTGGTGCTTGGCTATG GCATCTTCCACTGCTACATGGAGTACTCGAGACTCCGTGGAGAGGCAGGCTCCGACGTC

TCCCTGGTGGACCTTGGCTTCCAGACGGACCTCCGAGTGTACCTGCACTTGAGGCAGACCTGGATGGCTTTTA TGATCATTTTAAGCATCCTGGAAGTG

GTCATCATCCTGTTACTTATCTTTCTGCGCAAAAGGATATTGATCGCCATCGCCCTCATCAAAGAAGCCAGCAG GGCTGTGGGACATGTCATGTGCTCC

CTGCTCTACCCACTGGTGACCTTCTTCCTCTTGTGTCTCTGCATTGCCTACTGGGCCAGCACTTCTGT ATTCCTGTCCACCTCCAACACCGCCGTGTAC

AAGGTTGTTGATGACACAGCCTGCCCACTTCTGAGGAAAACCTGCAACCCAGAG ACCTTCCCCTTGCGGAATGAGAGCCTCCAGTGTCCCACTGCCCGC

TGCCAGTTTGCCTTCTATGGTGGCGAATCGACCTACCACCGTGCCCTGCTGGGCCTGCAGATCTTCAATGCATTCATGTTCTTCTGGCTAGCCAACTTCG

TGCTGGCCCTAGGCCAGGTAACCCTGGCCGGAGCCTTTGCCTCCTATTACTGGGCTATGCGGAAGCCTGATGATATGCCTGCCTTCCCCCTCTTCTCTGC

TTTTGGCCGAGCACTCAG - UNI10667 - GTACCACACGGGCTCCTTAGCTTTTGGCTCCCTTATCTTAGCCATCGTGCAGATCATCCGAGTGATGC

TGGAATACCTGGACCAGCGCCTAAAAG CTGCACAGAACAAGTTTGCCAAGTTCCTCATGGTCTGTCTCAAGTGCTGCTTCTGGTGCCTAGAGAAGTTTA

TCAAATTCCTGAATAGGAATGCCTACATCATG ATTGCTATCTATGGCACCAACTTCTGTACCTCAGCCAGGAATGCCTTCTTCCTGCTTATGAGAAATA

TCATCAG GGTGGCCGTCCTGGACAAAGTTACAGACTTCCTCTTCCTGTTGGGCAAACTTCTGATTGTGGGTAGTGTGG GCATCCTGGCCTTCTTCTTC

TTCACCCATCGGATCAGAATTGTGCAAGATACAGCCCCACCTCTCAATTATTACTGGGTTCCGATCCTG - UNI36121 - ACAGTGATCATTGGCTC

CTACTTGATCGCGCACGGCTTCTTCAGCGTCTATGGCATGTGCGTGGACACGCTGTTCCTCTGTTTCT - UNI22962 - TGGAGGATCTGGAGAGAA

ATGACGGTTCAGCCGAGAGGCCTTACTTCATGTCTTCCACTCTCAAGAAACTCTTGAATAAAACCAACAAGAAAGTAGCAGAATCCTAAAGACACCTGCC

TCCCAGCCCTCTCAGGACGCCGGGATAGGTGCTTGCTGTGCAGCTGGGTCAGAGTCCCCAGCTCATCAGACTTGCCTAACACATCACTGCCTCTCTGCAC

CCTCCCCGAGTTCCCATTTCCAGGAACCTAGAGGACTGGGGCATCTCTTTCCTATGCCAAAGGGCACTTGGGAGTTTTCAGTGCAGCCCTGGAAGATGGG

ACAGAATGGATCTCTCCAGCTCTTACTGGCTCAGATGGTGCCAATATGGTGAAGTAACTTGAAGTCGAGGATGGGAGATGGCCCTAGGATGTCTGCAGCA

AGCTTCTTTGTATTTCAGTAACCCTTCTGGCCAAGAGGGAAAGACTGGATGAGAGTGGGCAAGTCAGCTCAGCGAACACTAGCGCCAAGCTCCCCAGCGG

GGACAGAATTGGATCTCCATAGCTGATGTACCTAAGGGCCAGCAAATACACGTCTCACTCTTAGTCCTTTGTAGCCTAGGCAGACAGTAAGGGATCTACC

TGCTTCTCTTCCATCAGGCTCCAGAACTGGATGGAGCCACCAAGAGTGCCTTCATATGTAACCCCACCTCCAGCGTGGGCTGGCTATGGTCACAGGAAGA

AGTGTGCACCCAGAACTGGAGGAGTCTTCTGGATAAACAGACAGCATCTGCGAGGAGGGCCCTGTGTGAGGAACGATTGGTGTTGCTGCTGGTGGTTGGG

AGTAGTTGTGGAAAGCAGGCCTCTGTACTTAGACCCTACAGAGTTGCTTTGACTGATGACTTCTAAATGGAAAACTTGAGGTTGGAAAATGAATGAAAAT

AGGGCCTGTCTCCCCAGCCCTTTTTCTGCCAGTAATGCACACTGCTCTCTTTGTAAGAGATGAGAAACTTAAGTTCACCCAAGGGATGGTTTCAGGGACT

GAGGTGTGGGTGTGTTCTATATTCCAAATTAACTAGGCCTATCTGGTTTCTTTCACTTGAAACTAGAGAATCTGTTTGCCAAACTTCTTGATCTTGGGAG

CCAGTAGACTGGTTCTTCACTTTACCTACCGTATGCTAAGGCCCGCCCCTCACCCCTACTTTGGCCATCCGTAAGATAGCAGGATCTTGGAGACACCGCT

CCCAGCCTGAGGTCCCAAGGTTTCCTGTGCCTGCCTTGTGTGCCATCCCAACCCACCCTCTTGTATGCCCAGCCCTGTGCTTATGTAATTGCATTCCGGC

CAGTTAATAAAGTGCCTCTTGTACAG
Translation
MGKDSQNYYGKHG GTPQKYDPTFKGPIYNR - UNI22061 - RGCTDVICCVLLFLAIVGYVAVGIIA - UNI14365 - AWTHGDPRKVIYPTD

SRGEFCGQKGTKNA ADKPFLFYFNIVKCANPLVLLEFHCPTPQ ICVKQCPDRYLTLLSARNTRDFDYYKQFCVPGFQNNK GVTEILRDGECPAVITP

SKPL LAQRCFPAIHASKGVLMVGNETTYEDGHGARKNITDLVEGAK KKANKILEARQLAMQIFEDYTVSWYWIII IGLVIAMVLSLLFIVLLRFLAG

IMVWVMIVMVILVLGYG GIFHCYMEYSRLRGEAGSDVSLVDLGFQTDLRVYLHLRQTWMAFM MIILSILEVVIILLLIFLRKRILIAIALIKEASR R

AVGHVMCSLLYPLVTFFLLCLCIAYWASTSV VFLSTSNTAVYKVVDDTACPLLRKTCNPE TFPLRNESLQCPTARCQFAFYGGESTYHRALLGLQIFN

AFMFFWLANFVLALGQVTLAGAFASYYWAMRKPDDMPAFPLFSAFGRALR - UNI10667 - RYHTGSLAFGSLILAIVQIIRVMLEYLDQRLKA AA

QNKFAKFLMVCLKCCFWCLEKFIKFLNRNAYIM IAIYGTNFCTSARNAFFLLMRNIIR RVAVLDKVTDFLFLLGKLLIVGSVG GILAFFFFTHRIRI

VQDTAPPLNYYWVPIL - UNI36121 - TVIIGSYLIAHGFFSVYGMCVDTLFLCFL - UNI22962 - LEDLERNDGSAERPYFMSSTLKKLLNK

TNKKVAES
Transcript ENSMUST00000030045
Sequence
ATGGAGGACGATCGGAAGGACGCAGTCTATG - UNI32452 - GGACGCCTCAGAAATACGACCCCACCTTCAAAGGACCCATTTACAACAG - UNI

22061 - GGGATGCACAGATGTCATTTGCTGTGTGTTGCTCTTCCTGGCCATCGTAGGCTATGTGGCTGTGGGCATCATAG - UNI14365 - CCTG

GACCCATGGAGACCCTCGGAAGGTGATCTACCCCACTGATAGCCGGGGCGAATTCTGTGGGCAAAAGGGGACAAAAAATGC GGACAAACCGTTCTTGTT

TTACTTCAACATCGTGAAGTGTGCCAACCCCCTGGTCCTGCTGGAATTTCACTGTCCCACCCCTCAG ATCTGCGTGAAGCAGTGTCCAGACCGCTATCT

CACCCTTCTGAGTGCGCGCAACACTCGCGACTTTGACTATTACAAGCAGTTCTGTGTGCCTGGCTTCCAGAACAATAAA GGGGTGACTGAGATACTCCG

AGATGGGGAGTGTCCAGCGGTTATCACCCCCAGCAAACCTT TGGCCCAGCGGTGCTTTCCCGCCATCCATGCCAGCAAAGGAGTCCTCATGGTGGGCAA

TGAGACGACCTATGAGGACGGACATGGCGCCAGAAAGAACATTACAGATCTAGTGGAGGGTGCCAA AAAGGCCAACAAGATTCTAGAGGCCCGGCAACT

CGCCATGCAGATATTTGAAGATTACACTGTATCCTGGTACTGGATTATCAT AGGTCTGGTCATTGCCATGGTGCTGAGTCTCCTGTTCATCGTCCTGCT

GCGATTCCTGGCTGGCATTATGGTCTGGGTGATGATTGTCATGGTGATCCTGGTGCTTGGCTATG GCATCTTCCACTGCTACATGGAGTACTCGAGACT

CCGTGGAGAGGCAGGCTCCGACGTCTCCCTGGTGGACCTTGGCTTCCAGACGGACCTCCGAGTGTACCTGCACTTGAGGCAGACCTGGATGGCTTTTA T

GATCATTTTAAGCATCCTGGAAGTGGTCATCATCCTGTTACTTATCTTTCTGCGCAAAAGGATATTGATCGCCATCGCCCTCATCAAAGAAGCCAGCAG 

GGCTGTGGGACATGTCATGTGCTCCCTGCTCTACCCACTGGTGACCTTCTTCCTCTTGTGTCTCTGCATTGCCTACTGGGCCAGCACTTCTGT ATTCCT

GTCCACCTCCAACACCGCCGTGTACAAGGTTGTTGATGACACAGCCTGCCCACTTCTGAGGAAAACCTGCAACCCAGAG ACCTTCCCCTTGCGGAATGA

GAGCCTCCAGTGTCCCACTGCCCGCTGCCAGTTTGCCTTCTATGGTGGCGAATCGACCTACCACCGTGCCCTGCTGGGCCTGCAGATCTTCAATGCATTC

ATGTTCTTCTGGCTAGCCAACTTCGTGCTGGCCCTAGGCCAGGTAACCCTGGCCGGAGCCTTTGCCTCCTATTACTGGGCTATGCGGAAGCCTGATGATA

TGCCTGCCTTCCCCCTCTTCTCTGCTTTTGGCCGAGCACTCAG - UNI10667 - GTACCACACGGGCTCCTTAGCTTTTGGCTCCCTTATCTTAGCC

ATCGTGCAGATCATCCGAGTGATGCTGGAATACCTGGACCAGCGCCTAAAAG CTGCACAGAACAAGTTTGCCAAGTTCCTCATGGTCTGTCTCAAGTGC

TGCTTCTGGTGCCTAGAGAAGTTTATCAAATTCCTGAATAGGAATGCCTACATCATG ATTGCTATCTATGGCACCAACTTCTGTACCTCAGCCAGGAAT

GCCTTCTTCCTGCTTATGAGAAATATCATCAG GGTGGCCGTCCTGGACAAAGTTACAGACTTCCTCTTCCTGTTGGGCAAACTTCTGATTGTGGGTAGT

GTGG GCATCCTGGCCTTCTTCTTCTTCACCCATCGGATCAGAATTGTGCAAGATACAGCCCCACCTCTCAATTATTACTGGGTTCCGATCCTG - UNI

36121 - ACAGTGATCATTGGCTCCTACTTGATCGCGCACGGCTTCTTCAGCGTCTATGGCATGTGCGTGGACACGCTGTTCCTCTGTTTCT - UNI2

2962 - TGGAGGATCTGGAGAGAAATGACGGTTCAGCCGAGAGGCCTTACTTCATGTCTTCCACTCTCAAGAAACTCTTGAATAAAACCAACAAGAAAG

TAGCAGAATCCTAAAGACACCTGCCTCCCAGCCCTCTCAGGACGCCGGGATAGGTGCTTGCTGTGCAGCTGGGTCAGAGTCCCCAGCTCATCAGACTTGC

CTAACACATCACTGCCTCTCTGCACCCTCCCCGAGTTCCCATTTCCAGGAACCTAGAGGACTGGGGCATCTCTTTCCTATGCCAAAGGGCACTTGGGAGT

TTTCAGTGCAGCCCTGGAAGATGGGACAGAATGGATCTCTCCAGCTCTTACTGGCTCAGATGGTGCCAATATGGTGAAGTAACTTGAAGTCGAGGATGGG

AGATGGCCCTAGGATGTCTGCAGCAAGCTTCTTTGTATTTCAGTAACCCTTCTGGCCAAGAGGGAAAGACTGGATGAGAGTGGGCAAGTCAGCTCAGCGA

ACACTAGCGCCAAGCTCCCCAGCGGGGACAGAATTGGATCTCCATAGCTGATGTACCTAAGGGCCAGCAAATACACGTCTCACTCTTAGTCCTTTGTAGC

CTAGGCAGACAGTAAGGGATCTACCTGCTTCTCTTCCATCAGGCTCCAGAACTGGATGGAGCCACCAAGAGTGCCTTCATATGTAACCCCACCTCCAGCG

TGGGCTGGCTATGGTCACAGGAAGAAGTGTGCACCCAGAACTGGAGGAGTCTTCTGGATAAACAGACAGCATCTGCGAGGAGGGCCCTGTGTGAGGAACG

ATTGGTGTTGCTGCTGGTGGTTGGGAGTAGTTGTGGAAAGCAGGCCTCTGTACTTAGACCCTACAGAGTTGCTTTGACTGATGACTTCTAAATGGAAAAC

TTGAGGTTGGAAAATGAATGAAAATAGGGCCTGTCTCCCCAGCCCTTTTTCTGCCAGTAATGCACACTGCTCTCTTTGTAAGAGATGAGAAACTTAAGTT

CACCCAAGGGATGGTTTCAGGGACTGAGGTGTGGGTGTGTTCTATATTCCAAATTAACTAGGCCTATCTGGTTTCTTTCACTTGAAACTAGAGAATCTGT

TTGCCAAACTTCTTGATCTTGGGAGCCAGTAGACTGGTTCTTCACTTTACCTACCGTATGCTAAGGCCCGCCCCTCACCCCTACTTTGGCCATCCGTAAG

ATAGCAGGATCTTGGAGACACCGCTCCCAGCCTGAGGTCCCAAGGTTTCCTGTGCCTGCCTTGTGTGCCATCCCAACCCACCCTCTTGTATGCCCAGCCC

TGTGCTTATGTAATTGCATTCCGGCCAGTTAATAAAGTGCCTCTTGTACAG
Translation
MEDDRKDAVYG - UNI32452 - GTPQKYDPTFKGPIYNR - UNI22061 - RGCTDVICCVLLFLAIVGYVAVGIIA - UNI14365 - AWTH

GDPRKVIYPTDSRGEFCGQKGTKNA ADKPFLFYFNIVKCANPLVLLEFHCPTPQ ICVKQCPDRYLTLLSARNTRDFDYYKQFCVPGFQNNK GVTEIL

RDGECPAVITPSKPL LAQRCFPAIHASKGVLMVGNETTYEDGHGARKNITDLVEGAK KKANKILEARQLAMQIFEDYTVSWYWIII IGLVIAMVLSL

LFIVLLRFLAGIMVWVMIVMVILVLGYG GIFHCYMEYSRLRGEAGSDVSLVDLGFQTDLRVYLHLRQTWMAFM MIILSILEVVIILLLIFLRKRILIA

IALIKEASR RAVGHVMCSLLYPLVTFFLLCLCIAYWASTSV VFLSTSNTAVYKVVDDTACPLLRKTCNPE TFPLRNESLQCPTARCQFAFYGGESTY

HRALLGLQIFNAFMFFWLANFVLALGQVTLAGAFASYYWAMRKPDDMPAFPLFSAFGRALR - UNI10667 - RYHTGSLAFGSLILAIVQIIRVMLE

YLDQRLKA AAQNKFAKFLMVCLKCCFWCLEKFIKFLNRNAYIM IAIYGTNFCTSARNAFFLLMRNIIR RVAVLDKVTDFLFLLGKLLIVGSVG GIL

AFFFFTHRIRIVQDTAPPLNYYWVPIL - UNI36121 - TVIIGSYLIAHGFFSVYGMCVDTLFLCFL - UNI22962 - LEDLERNDGSAERPYF

MSSTLKKLLNKTNKKVAES

For any suggestions or comments, please send an email to unitrap@crg.es