Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000057195 (Ceacam13)
Chromosomal location
Chr 7: 18595238 - 18604570 (+)
Description
carcinoembryonic antigen-related cell adhesion molecule 13 Gene [Source:MGI (curated);Acc:Ceacam13-001]
RefSeq_dna
NM_028171 NM_027210 
RefSeq_peptide
NP_082447.1 NP_081486.1 
UniGene
Mm.46086 
MGI
MGI:1917035 
Uniprot/SPTREMBL
Q9DAT7 Q9DAY4 
Human Ortholog
not available
Omim not available
UniTrap UNI14011
Vector Insertion
Chr 7: 18598838 - 18604430
Public Clones CMHD-GT_162D10-3 (cmhd)
Private Clones not available
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000081703
Sequence
AGGAGAGTTGAGTGTGGAAACAGCACTGGAGCTGAAGCTTTTCACAGATGTAGACAGAGCAGGTGGCAGGTGGCAGAGGTCATGATGAACTCTGCTGCAC

TTTCCTGTAAAGACTGCACCTCTTGGCAGGGGCTTCTGTTCACAG TCTCTCTTTTAACATGCTGGCTGCATCCCACTACTTCTCATCTCACCATTAAAG

CAGTGCCTCCCATTGCTGTTGAAGGGGAAAACGTTCTTCTGTTTGTGCATAACCTGCCAAAGAATGTTAAAGCCTTTTCCTGGTACTCGGGAGCTGCACC

GTTCAAGTGTTGTGAAATTGCAAGTCATGTGATAGCTACCAATTTTACTGCAGTGGGACTTGCACACAGTGGTAGAGAGACAGTACTCAACAATGGATCT

CTGTTGATCAAGAGTGTTACCAGAAAAGACTCAGGATACTACACTCTACGAACACTTGATTCAACCTCAAGACCTGAAATAATACGTGCAGAATTCTTTG

TACACC GCCCACTATTAGGCTACAAGAAGCATCTTACCCCTTCTCAACTCACAATTCAGTTGGTGCCACTTAGGGTTGAAGAAAACATCAATATTTTTC

TGTCGGTTTTTAATCTGCCAAAGAAGCTTCAAGTCTTTGCCTGGCACAAAGGAGTACTTCCACTTGAACATTTGAAGATAGCAAGCCATTCATTCCTCAC

CAATTCAACCACTCTGGGGTATGCATATTATGACAGAGTGAAAGTACGCAATGATGGGTCCTTGCTTCTCTTCAATGTCAAGAAGAAAGACGCAGGGCTT

TATACCCTACGAACCGTATCTGTTGATTTGATATCAGAATGGGCCATTATTGACCTCCAAGTAAATAGTAAGTGACTCTTTGCGACTCCTGGGTGAAGGT

GGGGTTTATTCTTCTCTGTATACCTAAGACAATGAGGATTGTACTGTG
Translation
MMNSAALSCKDCTSWQGLLFTV VSLLTCWLHPTTSHLTIKAVPPIAVEGENVLLFVHNLPKNVKAFSWYSGAAPFKCCEIASHVIATNFTAVGLAHSGR

ETVLNNGSLLIKSVTRKDSGYYTLRTLDSTSRPEIIRAEFFVHR RPLLGYKKHLTPSQLTIQLVPLRVEENINIFLSVFNLPKKLQVFAWHKGVLPLEH

LKIASHSFLTNSTTLGYAYYDRVKVRNDGSLLLFNVKKKDAGLYTLRTVSVDLISEWAIIDLQVNSK
Transcript ENSMUST00000108488
Sequence
AGGAGAGTTGAGTGTGGAAACAGCACTGGAGCTGAAGCTTTTCACAGATGTAGACAGAGCAGGTGGCAGGTGGCAGAGGTCATGATGAACTCTGCTGCAC

TTTCCTGTAAAGACTGCACCTCTTGGCAGGGGCTTCTGTTCACAG TCTCTCTTTTAACATGCTGGCTGCATCCCACTACTTCTCATCTCACCATTAAAG

CAGTGCCTCCCATTGCTGTTGAAGGGGAAAACGTTCTTCTGTTTGTGCATAACCTGCCAAAGAATGTTAAAGCCTTTTCCTGGTACTCGGGAGCTGCACC

GTTCAAGTGTTGTGAAATTGCAAGTCATGTGATAGCTACCAATTTTACTGCAGTGGGACTTGCACACAGTGGTAGAGAGACAGTACTCAACAATGGATCT

CTGTTGATCAAGAGTGTTACCAGAAAAGACTCAGGATACTACACTCTACGAACACTTGATTCAACCTCAAGACCTGAAATAATACGTGCAGAATTCTTTG

TACACC GCCCACTATTAGGCTACAAGAAGCATCTTACCCCTTCTCAACTCACAATTCAGTTGGTGCCACTTAGGGTTGAAGAAAACATCAATATTTTTC

TGTCGGTTTTTAATCTGCCAAAGAAGCTTCAAGTCTTTGCCTGGCACAAAGGAGTACTTCCACTTGAACATTTGAAGATAGCAAGCCATTCATTCCTCAC

CAATTCAACCACTCTGGGGTATGCATATTATGACAGAGTGAAAGTACGCAATGATGGGTCCTTGCTTCTCTTCAATGTCAAGAAGAAAGACGCAGGGCTT

TATACCCTACGAACCGTATCTGTTGATTTGATATCAGAATGGGCCATTATTGACCTCCAAGTAAATA - UNI14011 - CACCTTGAAGTCAGGCTTC

AGACAATCAAGGAAGAAGATGTAAACCATGGCCCTTGAAGAATCAAAGAAGAAAGGCAAATATGTGCATTACTTCTACCCTTACTCTCTACTCTGAATAA

ATAGCTTTCTGCTTACCTGCA
Translation
MMNSAALSCKDCTSWQGLLFTV VSLLTCWLHPTTSHLTIKAVPPIAVEGENVLLFVHNLPKNVKAFSWYSGAAPFKCCEIASHVIATNFTAVGLAHSGR

ETVLNNGSLLIKSVTRKDSGYYTLRTLDSTSRPEIIRAEFFVHR RPLLGYKKHLTPSQLTIQLVPLRVEENINIFLSVFNLPKKLQVFAWHKGVLPLEH

LKIASHSFLTNSTTLGYAYYDRVKVRNDGSLLLFNVKKKDAGLYTLRTVSVDLISEWAIIDLQVNT - UNI14011 - TP
Transcript ENSMUST00000108489
Sequence
AGTTGAGTGTGGAAACAGCACTGGAGCTGAAGCTTTTCACAGATGTAGACAGAGCAGGTGGCAGGTGGCAGAGGTCATGATGAACTCTGCTGCACTTTCC

TGTAAAGACTGCACCTCTTGGCAGGGGCTTCTGTTCACAG TCTCTCTTTTAACATGCTGGCTGCATCCCACTACTTCTCATCTCACCATTAAAGCAGTG

CCTCCCATTGCTGTTGAAGGGGAAAACGTTCTTCTGTTTGTGCATAACCTGCCAAAGAATGTTAAAGCCTTTTCCTGGTACTCGGGAGCTGCACCGTTCA

AGTGTTGTGAAATTGCAAGTCATGTGATAGCTACCAATTTTACTGCAGTGGGACTTGCACACAGTGGTAGAGAGACAGTACTCAACAATGGATCTCTGTT

GATCAAGAGTGTTACCAGAAAAGACTCAGGATACTACACTCTACGAACACTTGATTCAACCTCAAGACCTGAAATAATACGTGCAGAATTCTTTGTACAC

C GCCCACTATTAGGCTACAAGAAGCATCTTACCCCTTCTCAACTCACAATTCAGTTGGTGCCACTTAGGGTTGAAGAAAACATCAATATTTTTCTGTCG

GTTTTTAATCTGCCAAAGAAGCTTCAAGTCTTTGCCTGGCACAAAGGAGTACTTCCACTTGAACATTTGAAGATAGCAAGCCATTCATTCCTCACCAATT

CAACCACTCTGGGGTATGCATATTATGACAGAGTGAAAGTACGCAATGATGGGTCCTTGCTTCTCTTCAATGTCAAGAAGAAAGACGCAGGGCTTTATAC

CCTACGAACCGTATCTGTTGATTTGATATCAGAATGGGCCATTATTGACCTCCAAGTAAATA - UNI14011 - CACCTTGAAGTCAGGCTTCAGACA

ATCAAGGAAGAAGATGTAAACCATGGCCCTTGAAGAATCAAAGAAGAAAGGCAAATATGTGCATTACTTCTACCCTTACTCTCTACTCTGAATAAATAGC

TTTCTGCTTACCTGC
Translation
VECGNSTGAEAFHRCRQSRWQVAEVMMNSAALSCKDCTSWQGLLFTV VSLLTCWLHPTTSHLTIKAVPPIAVEGENVLLFVHNLPKNVKAFSWYSGAAP

FKCCEIASHVIATNFTAVGLAHSGRETVLNNGSLLIKSVTRKDSGYYTLRTLDSTSRPEIIRAEFFVHR RPLLGYKKHLTPSQLTIQLVPLRVEENINI

FLSVFNLPKKLQVFAWHKGVLPLEHLKIASHSFLTNSTTLGYAYYDRVKVRNDGSLLLFNVKKKDAGLYTLRTVSVDLISEWAIIDLQVNT - UNI140

11 - TP

For any suggestions or comments, please send an email to unitrap@crg.es