Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000057229 (Atp5sl)
Chromosomal location
Chr 7: 26404453 - 26410569 (+)
Description
ATP5S-like Gene [Source:MGI Symbol;Acc:MGI:1913599]
RefSeq_dna
NM_025504 
RefSeq_peptide
NP_079780.2 
UniGene
Mm.159956 
MGI
MGI:1913599 
Uniprot/SWISSPROT
Q9D7K5 
Uniprot/SPTREMBL
Q8CA44 Q9DCX4 
Human Ortholog
ENSG00000105341 (ATP5SL)
Omim not available
UniTrap UNI3358
Vector Insertion
Chr 7: 26404480 - 26405468
Public Clones XT0620 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000085953
Sequence
ATGCACACTATGCAC GTCCTGCACCTGGGCGCCCGAGAATGGAATGGCAGAGCCAGGCGCATCCATGGCATGAGTGAGTTGGTGACCCCGGACAGCAGT

CGGGAGAAGAAAAGAACGCTGTTGCAGTTCCTCTCAGATCATTTCCAGGACATCCAGACTCTGAGAGAGTACTTGCTCCAGAAACAGATCTCAAAAGTCA

ACAGGGAGAATCG ATCCTTCACTAACATCCAGGAGAAATATGGCCCGTATGTTGCAGGTGCTGTCTTCATCCTGAAGCAGGGAGGCGCAGTGAA GTTT

CAGGACAAGGAGGAATGGATCCGGCCAAATAACCGTAGCCATTTCCTCGCCGAGATTCAGAAGTTCCAGAATGTGCCTGTGGAGGCTGTGGATGCCAGTG

GCTGTGCCATCAACTACCAGGGCCTGAGTAACCTCT TGCCCCTGAAGGAGCTGCGGTCCCTGTCCCTGCAGCGCTGCCCCAACCTGGACGACTGGTGCC

TCAGCCGCCTCTACCTATTGGCTGGCTCACTGCAGGAGCTCTCGCTGGCTGGCTGCCCCAGAATCTCAGAACGGGGCCTTGCCTGCCTCCACCACCTCCA

 GAACCTCCGCAGGCTGGACATCTCAGACCTCCCTGCCGTGTCCCACCCAGGTCTCACTCAGATCCTGGTGGAAGAGATGTTGCCCCACTGTGAGGTCCT

TGGAGCTGACTGGGCCCAGAATCTCAAGCTGGAACCAGACAAGCAGCCTCCAGACACATCTACCCCCCTCTCTTCCTAGCCTGTGGCCCAGCTCTTGAAG

GGTCTTGTGGGCTCTGTGGAGAGTCTGAAGTCTTCTCACAGTCTGGCTTCTGGTGTAGCTCATTCAGCACGGAGCAGCATGGGAAGATAAGAAGACTGAG

TCAGGACTGGCTGACTGCAGCCTGCAACTGGCAAACATCTGTTGCCTGGGCAGACAGCCCTCCATGCTGTGACAGCTGCATGCGGCTCCACCGTTTCCCC

CAAACTCTGCCCATACACATCAGCAGGAACTGTGGCTGACATGAGACACTGCTGGCCTACACGGACTAGAGACCAGCAGCCCCCCGAGCCCCATGGCATT

ACCCATTGATTTACTGATGAGCACCTTCAAATGTGGGAGTCCCAGTGTGTCCGCCCACCCCACCCCCAGATGGAGATGAGTATTTGAGAAAATATTCTCT

TTCTGGCACGACCGCCGGAGAGAATCCAAAGTAAAGAGACCTGTGCGGGGACTTTAGAGTGTAGCAGGGAGGGCAGCACTTGCCCAGCACCCAGGCTGTT

GGGTGGCCAGCAGCTTCCCCTGGCACTCCTATCAACTGTGATTGATCCTGGCGCCCATGTTTCCGGTGGCTCTGTCATGAACCCAATACACTGTGGAAAT

GTGTGATTCTTTATATTAAACGTCTGCTGTTCACATT
Translation
MHTMH VLHLGAREWNGRARRIHGMSELVTPDSSREKKRTLLQFLSDHFQDIQTLREYLLQKQISKVNRENR RSFTNIQEKYGPYVAGAVFILKQGGAV

K KFQDKEEWIRPNNRSHFLAEIQKFQNVPVEAVDASGCAINYQGLSNLL LPLKELRSLSLQRCPNLDDWCLSRLYLLAGSLQELSLAGCPRISERGLA

CLHHLQ QNLRRLDISDLPAVSHPGLTQILVEEMLPHCEVLGADWAQNLKLEPDKQPPDTSTPLSS
Transcript ENSMUST00000077338
Sequence
CCTGGCAAGATGGCGGCGCCCAGAGCG - UNI3358 - GTCCTGCACCTGGGCGCCCGAGAATGGAATGGCAGAGCCAGGCGCATCCATGGCATGAGT

GAGTTGGTGACCCCGGACAGCAGTCGGGAGAAGAAAAGAACGCTGTTGCAGTTCCTCTCAGATCATTTCCAGGACATCCAGACTCTGAGAGAGTACTTGC

TCCAGAAACAGATCTCAAAAGTCAACAGGGAGAATCG ATCCTTCACTAACATCCAGGAGAAATATGGCCCGTATGTTGCAGGTGCTGTCTTCATCCTGA

AGCAGGGAGGCGCAGTGAA GTTTCAGGACAAGGAGGAATGGATCCGGCCAAATAACCGTAGCCATTTCCTCGCCGAGATTCAGAAGTTCCAGAATGTGC

CTGTGGAGGCTGTGGATGCCAGTGGCTGTGCCATCAACTACCAGGGCCTGAGTAACCTCT TGCCCCTGAAGGAGCTGCGGTCCCTGTCCCTGCAGCGCT

GCCCCAACCTGGACGACTGGTGCCTCAGCCGCCTCTACCTATTGGCTGGCTCACTGCAGGAGCTCTCGCTGGCTGGCTGCCCCAGAATCTCAGAACGGGG

CCTTGCCTGCCTCCACCACCTCCA GAACCTCCGCAGGCTGGACATCTCAGACCTCCCTGCCGTGTCCCACCCAGGTCTCACTCAGATCCTGGTGGAAGA

GATGTTGCCCCACTGTGAGGTCCTTGGAGCTGACTGGGCCCAGAATCTCAAGCTGGAACCAGACAAGCAGCCTCCAGACACATCTACCCCCCTCTCTTCC

TAGCCTGTGGCCCAGCTCTTGAAGGGTCTTGTGGGCTCTGTGGAGAGTCTGAAGTCTTCTCACAGTCTGGCTTCTGGTGTAGCTCATTCAGCACGGAGCA

GCATGGGAAGATAAGAAGACTGAGTCAGGACTGGCTGACTGCAGCCTGCAACTGGCAAACATCTGTTGCCTGGGCAGACAGCCCTCCATGCTGTGACAGC

TGCATGCGGCTCCACCGTTTCCCCCAAACTCTGCCCATACACATCAGCAGGAACTGTGGCTGACATGAGACACTGCTGGCCTACACGGACTAGAGACCAG

CAGCCCCCCGAGCCCCATGGCATTACCCATTGATTTACTGATGAGCACCTTCAAATGTGGGAGTCCCAGTGTGTCCGCCCACCCCACCCCCAGATGGAGA

TGAGTATTTGAGAAAATATTCTCTTTCTGGCACGACCGCCGGAGAGAATCCAAAGTAAAGAGACCTGTGCGGGGACTTTAGAGTGTAGCAGGGAGGGCAG

CACTTGCCCAGCACCCAGGCTGTTGGGTGGCCAGCAGCTTCCCCTGGCACTCCTATCAACTGTGATTGATCCTGGCGCCCATGTTTCCGGTGGCTCTGTC

ATGAACCCAATACACTGTGGAAATGTGTGATTCTTTATATTAAACGTCTGCTGTTCACATT
Translation
MAAPRA - UNI3358 - VLHLGAREWNGRARRIHGMSELVTPDSSREKKRTLLQFLSDHFQDIQTLREYLLQKQISKVNRENR RSFTNIQEKYGPYV

AGAVFILKQGGAVK KFQDKEEWIRPNNRSHFLAEIQKFQNVPVEAVDASGCAINYQGLSNLL LPLKELRSLSLQRCPNLDDWCLSRLYLLAGSLQELS

LAGCPRISERGLACLHHLQ QNLRRLDISDLPAVSHPGLTQILVEEMLPHCEVLGADWAQNLKLEPDKQPPDTSTPLSS

For any suggestions or comments, please send an email to unitrap@crg.es