Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000057367 (Birc2)
Chromosomal location
Chr 9: 7818236 - 7835269 (-)
Description
baculoviral IAP repeat-containing 2 Gene [Source:MGI Symbol;Acc:MGI:1197009]
RefSeq_dna
NM_007465 
RefSeq_peptide
NP_031491.2 
UniGene
Mm.335659 
MGI
MGI:1197009 
Uniprot/SWISSPROT
Q62210 
Uniprot/SPTREMBL
A6H6S7 
Human Ortholog
ENSG00000110330 (BIRC2)
Omim not available
UniTrap UNI37639
Vector Insertion
Chr 9: 7820973 - 7825664
Public Clones (cmhd)
Private Clones not available
Severity of mutation (?) Insertion after 60% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000074246
Sequence
TCTTGTGTATGATTAGTTATATAAAATACGAAGTTTTCAAAAAGAAGGCTAGTGCAACAGAAAAGCTTTGCTAAAACAGATTCTTAGTTATTTGAGGTAA

CAAAAGAAAGCCATGTCTTGAATTGATTCGTTCTTAATTATAACAGACTTATAGTGGAAAGGGCCTTAAACACAGGCGGACTTTATAAAATGCAGTCTTA

GGTTTATGTGCAAAATACTGTCTGTTGACCAGATGTATTCACATGATATATACAGAGTCAAGGTGGTGATATAGAAGATTTAACAGTGAGGGAGTTAACA

GTCTGTGCTTTAAGCGCAGTTCCTTTACAGTGAATACTGTAGTCTTAATAGACCTGAGCTGACTGCTGCAGTTGATGTAACCCACTTTAGAGAATACTGT

ATGACATCTTCTCTAAGGAAAACCAGCTGCAGACTTCACTCAGTTCCTTTCATTTCATAGGAAAAGGAGTAGTTCAGATGTCATGTTTAAGTCCTTATAA

GGGAAAAGAGCCTGAATATATGCCCTAGTACCTAGGCTTCATAACTAGTAATAAGAAGTTAGTTATGGGTAAATAGATCTCAGGTTACCCAGAAGAGTTC

ATGTGACCCCCAAAGAGTCCTAACTAGTGTCTTGGCAAGTGAGACAGATTTGTCCTGTGAGGGTGTCAATTCACCAGTCCAAGCAGAAGACAATGAATCT

ATCCAGTCAGGTGTCTGTGGTGGAGATCTAGTGTCAAGTGGTGAGAAACTTCATCTGGAAGTTTAAGCGGTCAGAAATACTATTACTACTCATGGACAAA

ACTGTCTCCCAGAGACTCGGCCAAGGTACCTTACACCAAAAACTTAAACGTATAATGGAGAAGAGCACAATCTTGTCAAATTGGACAAAGGAGAGCGAAG

AAAAAATGAAGTTTGACTTTTCGTGTGAACTCTACCGAATGTCTACATATTCAGCTTTTCCCAGGGGAGTTCCTGTCTCAGAGAGGAGTCTGGCTCGTGC

TGGCTTTTATTATACAGGTGTGAATGACAAAGTCAAGTGCTTCTGCTGTGGCCTGATGTTGGATAACTGGAAACAAGGGGACAGTCCTGTTGAAAAGCAC

AGACAGTTCTATCCCAGCTGCAGCTTTGTACAGACTCTGCTTTCAGCCAGTCTGCAGTCTCCATCTAAGAATATGTCTCCTGTGAAAAGTAGATTTGCAC

ATTCGTCACCTCTGGAACGAGGTGGCATTCACTCCAACCTGTGCTCTAGCCCTCTTAATTCTAGAGCAGTGGAAGACTTCTCATCAAGGATGGATCCCTG

CAGCTATGCCATGAGTACAGAAGAGGCCAGATTTCTTACTTACAGTATGTGGCCTTTAAGTTTTCTGTCACCAGCAGAGCTGGCCAGAGCTGGCTTCTAT

TACATAGGGCCTGGAGACAGGGTGGCCTGTTTTGCCTGTGGTGGGAAACTGAGCAACTGGGAACCAAAGGATGATGCTATGTCAGAGCACCGCAGACATT

TTCCCCACTGTCCATTTCTGGAAAATACTTCAGAAACACAGAGGTTTAGTATATCAAATCTAAGTATGCAGACACACTCTGCTCGATTGAGGACATTTCT

GTACTGGCCACCTAGTGTTCCTGTTCAGCCCGAGCAGCTTGCAAGTGCTGGATTCTATTACGTGGATCGCAATGATGATGTCAAGTGCTTTTGTTGTGAT

GGTGGCTTGAGATGTTGGGAACCTGGAGATGACCCCTGGATAGAACACGCCAAATGGTTTCCAAG GTGTGAGTTCTTGATACGGATGAAGGGTCAGGAG

TTTGTTGATGAGATTCAAGCTAGATATCCTCATCTTCTTGAGCAG - UNI37639 - CTGTTGTCCACTTCAGACACCCCAGGAGAAGAAAATGCTGA

CCCTACAG - UNI37639 - AGACAGTGGTGCATTTTGGCCCTGGAGAAAGTTCGGAAGATGTCGTCATGATGAGCACGCCTGTGGTTAAAGCAGCCT

TGGAAATGGGCTTCAGTAGGAGCCTGGTGAGACAGACGGTTCAGCGGCAGATCCTGGCCACTGGTGAGAACTACAGGACCGTCAATGATATTGTCTCAGT

ACTTTTGAATGCTGAAGATGAGAGAAGAGAAGAGGAGAAGGAAAGACAGACTGAAGAGATGGCATCAG - UNI37639 - GTGACTTATCACTGATTC

GGAAGAATAGAATGGCCCTCTTTCAACAGTTGACACATGTCCTTCCTATCCTGGATAATCTTCTTGAGGCCAGTGTAATTACAAAACAGGAACATGATAT

TATTAGACAGAAAACACAGATACCCTTACAAGCAAGAGAGCTTATTGACACCGTTTTAGTCAAGGGAAATGCTGCAGCCAACATCTTCAAAAACTCTCTG

AAGGAAATTGACTCCACGTTATATGAAAACTTATTTG TGGAAAAGAATATGAAGTATATTCCAACAGAAGACGTTTCAG GCTTGTCATTGGAAGAGCA

GTTGCGGAGATTACAAGAAGAACGAACTTGCAAAGTGTGTATGGACAGAGAGGTTTCTATTGTGTTCATTCCGTGTGGTCATCTAGTAGTCTGCCAGGAA

TGTGCCCCTTCTCTAAGGAAGTGCCCCATCTGCAGGGGGACAATCAAGGGGACTGTGCGCACATTTCTCTCATGAGTGAAGAATGGTCTGAAAGTATTGT

TGGACATCAGAAGCTGTCAGAACAAAGAATGAACTACTGATTTCAGCTCTTCAGCAGGACATTCTACTCTCTTTCAAGATTAGTAATCTTGCTTTATGAA

GGGTAGCATTGTATATTTAAGCTTAGTCTGTTGCAAGGGAAGGTCTATGCTGTTGAGCTACAGGACTGTGTCTGTTCCAGAGCAGGAGTTGGGATGCTTG

CTGTATGTCCTTCAGGACTTCTTGGATTTGGAATTTGTGAAAGCTTTGGATTCAGGTGATGTGGAGCTCAGAAATCCTGAAACCAGTGGCTCTGGTACTC

AGTAGTTAGGGTACCCTGTGCTTCTTGGTGCTTTTCCTTTCTGGAAAATAAGGATTTTTCTGCTACTGGTAAATATTTTCTGTTTGTGAGAAATATATTA

AAGTGTTTCTTTTAAAGGCGTGCATCATTGTAGTGTGTGCAGGGATGTATGCAGGCAAAACACTGTGTATATAATAAATAAATCTTTTT
Translation
MDKTVSQRLGQGTLHQKLKRIMEKSTILSNWTKESEEKMKFDFSCELYRMSTYSAFPRGVPVSERSLARAGFYYTGVNDKVKCFCCGLMLDNWKQGDSPV

EKHRQFYPSCSFVQTLLSASLQSPSKNMSPVKSRFAHSSPLERGGIHSNLCSSPLNSRAVEDFSSRMDPCSYAMSTEEARFLTYSMWPLSFLSPAELARA

GFYYIGPGDRVACFACGGKLSNWEPKDDAMSEHRRHFPHCPFLENTSETQRFSISNLSMQTHSARLRTFLYWPPSVPVQPEQLASAGFYYVDRNDDVKCF

CCDGGLRCWEPGDDPWIEHAKWFPR RCEFLIRMKGQEFVDEIQARYPHLLEQ - UNI37639 - LLSTSDTPGEENADPTE - UNI37639 - ET

VVHFGPGESSEDVVMMSTPVVKAALEMGFSRSLVRQTVQRQILATGENYRTVNDIVSVLLNAEDERREEEKERQTEEMASG - UNI37639 - GDLSL

IRKNRMALFQQLTHVLPILDNLLEASVITKQEHDIIRQKTQIPLQARELIDTVLVKGNAAANIFKNSLKEIDSTLYENLFV VEKNMKYIPTEDVSG GL

SLEEQLRRLQEERTCKVCMDREVSIVFIPCGHLVVCQECAPSLRKCPICRGTIKGTVRTFLS

For any suggestions or comments, please send an email to unitrap@crg.es