Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000057455 (Rit2)
Chromosomal location
Chr 18: 31132777 - 31476620 (-)
Description
Ras-like without CAAX 2 Gene [Source:MGI Symbol;Acc:MGI:108054]
RefSeq_dna
NM_009065 
RefSeq_peptide
NP_033091.1 
UniGene
Mm.5163 Mm.446239 
MGI
MGI:108054 
Uniprot/SWISSPROT
P70425 
Human Ortholog
ENSG00000152214 (RIT2)
Omim not available
UniTrap UNI17243
Vector Insertion
Chr 18: 31402832 - 31476494
Public Clones not available
Private Clones OST446887 (lexicon)
Severity of mutation (?) Insertion after 16% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI18655
Vector Insertion
Chr 18: 31313551 - 31372311
Public Clones not available
Private Clones OST418651 (lexicon) OST154843 (lexicon)
Severity of mutation (?) Insertion after 37% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI36210
Vector Insertion
Chr 18: 31132776 - 31313551
Public Clones CMHD-GT_234E3-3 (cmhd) IST10765D5 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 66% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000082070
Sequence
CCTCCTCGGGTCCCCCGAGTAAGATGGAAGTAGAAAACGAAGCCCACTGCTGCCCTGGCAGCTCATCAGGCGGGTCCAGAGAGTACAAGGTGGTAATGCT

GGGCGCAGGGGGCGTTGGTAAAAGCG - UNI17243 - CAGTCACAATGCAGTTTATAAGCCACCAGTTCCCGGACTATCACGACCCCACAATCG AA

GATGCTTATAAAACCCAGGTGAGGATTGATAATGAGCCTGCTTACTTAGACATCTTGGACACTGCTGGTCAG - UNI18655 - - UNI36210 - G

CAGAGTTCACGGCCATGCGGGAGCAGTACATGCGTGGGGGAGAGGGCTTCATCATCTGCTATTCTGTCACTGACCGCCAGTCATTCCAGGAGGCTGCCAA

GTTCAAGGAGCTTATTTTCCAGGTCCGTCACACCTATGAAATTCCCCTTGTGCTAGTGGGTAACAAAATTGACTTGGAGCAGTTCCGTCAG - UNI362

10 - GTATCTACAGAAGAAGGCATGAATCTTGCTCGAGACTACAACTGTGCCTTCTTTGAGACATCTGCAGCCCTGCGATTCGGTATCGATGATGCTTT

TCAAGGCTTAGTGAGAGAAATTCGCAGGAAGGAATCCATGCTGTCCTTGGTGGAAAGGAAATTGAAGAGGAAGGACAGCCTGTGGAAGAAGATAAAAGCC

TCCCTGAAGAAGAAGAGAGAAAACATGTTGTGAGGCTTTGCTTCCGCATCCTTCCTGTCTCTCCTTGTGGGTTTTATCAACCAGACAATTGTTCATATCT

CCATCTCACTCTCTCTTTCTCTCTCCATCTCTTTTTCTTTCCCTTTCCCCCTCTCTTAACACACACACACACACAATCTACCTGCAGGCAGAAATTAGAC

TTCTATAACTGTGTGTCTTGAGATAGTTTTATTTTGCCTTTAACAGCTGGATAGATTTTGTCAATCAGCTGGATAATGCTTTATAGATTTTACAATATAT

TACCAAATAAAATTAACATTCCAATTGCCTCATTTTCCTGTAAAGTGTAGCTTCATTTTGCATGCTGTCTGGTTATAAAGAAAATCTGCAAACTTGTAAC

TGGGATGATAAAAGGCTTAGGGGATCTGCTTTTGCCTGATAACCCTGGTTGTTTGCATTTCACAAATCTGTAAATAATGAAGAGGCTGGAATAGTTTAGA

GGAAAAAAAAATGTCCTTGTCTTCTCTTAAGTGGAAGAGTCTTGGTATTTCTTCTTGAGTCCTCTATAGATGAACATTAGAGAAATTATTGATAATAGGA

ACTGAGTTTGTGTTATTAAAATACTAAAATTACATGTCCCCATATTTAGTGCTCAGTCTGCCATATGCTTTATAGAAGTACCACAGTAAAGTTACTGTAA

TGATAGTCTATGTTATCTGTTGTAGGAAGACAGCAATACTATGAACTAGATGATACATGTGCCCAAGAAAGGACCCTTTGCCCCTCTCAATGAATCTTCT

TAGAATTGCTTCACCTGCATAGTAGCCATCTGTCTGCAGCGATATGGCCTCTACATACTAAGTGTTCTCTTCATATTATTAAATTTCCTCTCTCATTTTC

CAAGAAGCATTACAAGAAGCTGACATCAGAAATGTTGTTGTTATTTGTCTTGTTATTTGTTCATTGTGTAAAATAAAATCTCTCAGTCACCCATTTTCCC

CTTGTGCAAATTAGTTTGTTTAAATTCAAGCTCAGAAAGCAACCACTGGAAAGAATGATAATGGATGCGTGTTAAGAGGAAACTGAAAAAGCTAAGCCTA

AAACAGATCCGTCAAAACAATTTTCATGGATTGAGGCCAGTTTTATCATAAATTAGGGAACAGTAGAACTGAGGGACAAGGGTATCTTTCAGCAGTCAGT

CTCTTTCACTTCTTGGGCTCACAATGACCCTGAAACCAGATAAGTGCTGAGAATGGAGAAATGAGTCACACAAGCCCTAGCTTCCTGTAGTTTAACATTC

ACCTGGCAGACTTATTCCACTGAAGTAACACTGGAGTCATAAACACTTGTAAAGGAAAATGATACATTTCACATGTTTACAAACAAGGAAAGTACAGATA

AGGGGTTATCAATTCCTACCTGTTGGAATAAAACTCAATATTTCAGAATATTATATTTTAGAGTTACTTTATACTTTAGATTAAAATTCCTTTCTTAATC

CCACAAAATTTTTCTGTTTGTGTGTTAGGTCTTAGGATAAGGGGTTGATGTTATTGATCTCTTGTGTTGAGTTTTTCTTAAACCACATCTTTTATACATT

TTTTTCATTCATCCTAAAATTCTAATAATACCAAAAATACACTGTAAATTTCTCTCCTAAGGAATATATCATTTAAAAGGTATATCACAAAATGGAAAGA

AAAGATGAAACTTACTATTTCATAAAGACTGTAAGTCACTATGATTTTCATTTATATTAAGGCGACATATAACAACTATACATGTTAATAAAGGTCCATG

TGATATAGGAGTCTGACAGTTAGAACCTGCTTTTGCTATCTCCCTCCTTCCGTTTGGAATGACTAAGCCTTTTCTTTTCTTTTGTTAAATTGGCTCATTC

ACCTCCAGCATGTCCTTTGAGTCCTGAGTCTGAGTCTTAAGCCCTTCTATTTACCTCTCTGTTTTCACGGAAAACACAATTTAGAAAATAATTGGCACTA

CTTTCTCCATGATTGGCCTGTCTATTTGTAAACCTAGTGATTTCCTTGTCCACATGTCACACTTGACACATTTTCTCTAACACCAAGTGCTTAGGAGTTT

TATATTTCCTTTGACTCTTAAACGCTTTGTCACTGAGTTTTCCTGATGTTACCTTTACTTCTTCTTCACTATAAACCATGAGTAAAT
Translation
MEVENEAHCCPGSSSGGSREYKVVMLGAGGVGKSA - UNI17243 - AVTMQFISHQFPDYHDPTIE EDAYKTQVRIDNEPAYLDILDTAGQ - UN

I18655 - - UNI36210 - AEFTAMREQYMRGGEGFIICYSVTDRQSFQEAAKFKELIFQVRHTYEIPLVLVGNKIDLEQFRQ - UNI36210 - 

VSTEEGMNLARDYNCAFFETSAALRFGIDDAFQGLVREIRRKESMLSLVERKLKRKDSLWKKIKASLKKKRENML

For any suggestions or comments, please send an email to unitrap@crg.es