Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000057649 (Brd9)
Chromosomal location
Chr 13: 74075286 - 74098342 (+)
Description
bromodomain containing 9 Gene [Source:MGI Symbol;Acc:MGI:2145317]
RefSeq_dna
NM_001024508 
RefSeq_peptide
NP_001019679.2 
UniGene
Mm.475385 
MGI
MGI:2145317 
Uniprot/SWISSPROT
Q3UQU0 
Uniprot/SPTREMBL
Q3U3P9 
Human Ortholog
ENSG00000028310 (BRD9)
Omim not available
UniTrap UNI26106
Vector Insertion
Chr 13: 74075394 - 74075881
Public Clones not available
Private Clones OST137261 (lexicon)
Severity of mutation (?) Insertion after 3% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI5930
Vector Insertion
Chr 13: 74076446 - 74077684
Public Clones CSH204 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 22% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000099384
Sequence
GGCGCAGGTCGAGCTACCGGCAGCCGCTTCTCACCGGATCCCGTGCTATCTCAGCCATGGGCAAAAAGCACAAGAAGCACAAGGCGGAATGGCGCTCGTC

CTACGAAG - UNI26106 - ATTATACAGACACGCCACTGGAGAAGCCTCTGAAGCTGGTGCTCAAGGTGGGAGGAAGTGAAGTGACAGAGCTCTCAG

GATCTGGCCACGACTCCAGCTACTACGACGATCGCTCAGACCACGAACGGGAGAGACACAGAGAAAAGAAGAAAAAGAAGAAGAAAAAGTCAGAGAAGGA

GAAGCACCTCGATGAGGAGGAGAGGAGGAAGCGGAAG GAAGAGAAGAAACGGAAACGGGAGAAGGAACACTGCGACTCAGAGGGGGAGGCTGATGCTTT

CGACCCTGGAAAGAAGGTGGAGGTGGAGCCACCCCCAGACCGACCAGTGAGAGCCTGCCGAACACAGCCAG - UNI5930 - CTGAGAACGAGAGCAC

ACCTATCCAGAGGCTTCTGGAACACTTCCTCCGCCAGCTACAGAG AAAAGATCCTCATGGATTTTTTGCTTTTCCTGTTACGGATGCAATTGCTCCTGG

GTATTCAATGATAATAAAACATCCTATGGACTTTGGCACGATGAAAGACAAGATTGTAGCTAATGAATATAAATCAGTCACAGAATTTAAG GCAGATTT

CAAATTAATGTGTGATAATGCGATGACGTACAATAGACCAGACACCGTGTACTACAAATTAGCCAAGAAGATCCTGCACGCGGGCTTTAAGATGATGAGC

AAA CAGGCAGCTCTCTTGGGCAGTGAAGACCCAGCAGCTGAGGAACCTGTTCCCGAGGTTGTCCCAGTGCAAGTAGAAACTACCAAGAAATCCAAAAAG

CCGAGTAGAGAAGTTATCAG CTGCATGTTTGAGCCTGAAGGGAATGCCTGCAGCCTGACAGACAGCACGGCAGAGGAGCATGTGCTAGCCCTGGTAGAG

CACGCAGCTGATGAGGCTCGGGACAGGATTAACCGGTTTCTCCCGGGTGGCAAG ATGGGGTACCTGAAGAAGCTTGGAGATGGAAGTCTGCTCTACAGC

GTGGTGAACGCACCTGAGCCTGATGCTGATG AGGAGGAGACACACCCTGTGGACCTGAGTTCACTGTCTAGCAAGTTGCTCCCAGGTTTTACAACATTG

GGTTTCAAAGATGAAAGAAGAAATAAAG TCACATTCCTCTCCAGTGCCAGCACTGCACTTTCAATGCAGAACAACTCTGTGTTTGGGGACCTGAAGTCA

GATGAGATGGAGCTTCTGTATTCCGCCTATGGAGATGAGACTGGTGTGCAGTGTGCACTGAG CCTGCAGGAATTCGTGAAGGATGCTGGAAGCTATAGC

AAGAAGATGGTAGATGACCTCCTGGACCAAATCACAGGTGGTGATCACTCAAGGATGATCTTCCAGCTGAAGCAG AGGAGGAGCATCCCCATGAGACCT

GCAGATGAGATGAAG GTTGGGGATCCACTGGGAGAGAGTGGTGGCCCTGTTCTGGACTTCATGTCAATGAAACAGTATCCTGATGTCTCCCTGGATGTG

TCCATGCTCAGCTCTCTCG GGAAAGTAAAGAAGGAGCTGGACCATGAAGATAGCCACTTGAACTTGGATGAGACAGCCAGGCTCCTGCAGGACTTACAC

GAAGCACAAGCAGAGCGAGGAGGCTCTCGGCCATCCTCCAACCTTAGCTCTCTGTCCACTGCCTCTGAGAGGGAGCATCCTCCTCCAG GAAGTCCTTCT

CGCCTTAGTGTTGGGGAGCAGCCGGATGTCGCCCACGACCCTTATGAATTCCTTCAGTCTCCAGAACCTGCAGCTCCTGCCAAGAACTAACTTGTGGTGT

TCCCAGATGGTTTATTTTATTTTTCTACATTTTATTTGATACAGTTTTTGTCACAAGACAGAAACTTTTGTCTCATCCTCTCTGGCAAGTAGCAGCCTGA

GGAAGATGCTGGCTTGTCTGTACCGTCACGTCTGCAGCAGAGGCCCAGTAGCACCGAATGGTGTCCAATAAGCTCTGAGCAGTGGCAATAGAATGTCAAC

GGATTGCAATCAGATGGCTCAACTCTGTGTCTCCTGAGCACCAGCAGCCAAGCCTGTTCATGATGATGTGCACACAGTCATTCTACAGGAGCTTTGCACA

GCCTTCCTGCAGTTCTCAAAGGGGAGCCTGCAGACTAGGCCTTCAGAGGGTTCCTTCTGTTTCCTATTTGGGCACTGAGCCAGAGGATGGAGTTGTCTCC

CTGACAAATAATGAACCACCCCACCTTTTAGAATGAAGTATAAATGAAGTCATAAAATGTTTCAATGTTTTGCTGAGTACCTGTTTGTATTTATAAAAAA

CATGAACACAGGTCCTAATAAAGAGATGCCTAAGGCGGTAACTCTG
Translation
MGKKHKKHKAEWRSSYED - UNI26106 - DYTDTPLEKPLKLVLKVGGSEVTELSGSGHDSSYYDDRSDHERERHREKKKKKKKKSEKEKHLDEEER

RKRK EEKKRKREKEHCDSEGEADAFDPGKKVEVEPPPDRPVRACRTQPA - UNI5930 - AENESTPIQRLLEHFLRQLQR RKDPHGFFAFPVTDA

IAPGYSMIIKHPMDFGTMKDKIVANEYKSVTEFK ADFKLMCDNAMTYNRPDTVYYKLAKKILHAGFKMMSK QAALLGSEDPAAEEPVPEVVPVQVETT

KKSKKPSREVIS SCMFEPEGNACSLTDSTAEEHVLALVEHAADEARDRINRFLPGGK MGYLKKLGDGSLLYSVVNAPEPDADE EEETHPVDLSSLSS

KLLPGFTTLGFKDERRNKV VTFLSSASTALSMQNNSVFGDLKSDEMELLYSAYGDETGVQCALS SLQEFVKDAGSYSKKMVDDLLDQITGGDHSRMIF

QLKQ RRSIPMRPADEMK VGDPLGESGGPVLDFMSMKQYPDVSLDVSMLSSLG GKVKKELDHEDSHLNLDETARLLQDLHEAQAERGGSRPSSNLSSL

STASEREHPPPG GSPSRLSVGEQPDVAHDPYEFLQSPEPAAPAKN

For any suggestions or comments, please send an email to unitrap@crg.es