Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000057789 (Bak1)
Chromosomal location
Chr 17: 27156759 - 27165571 (-)
Description
BCL2-antagonist/killer 1 Gene [Source:MGI (curated);Acc:Bak1-001]
RefSeq_dna
NM_007523 
RefSeq_peptide
NP_031549.2 
UniGene
Mm.2443 
MGI
MGI:1097161 
Uniprot/SWISSPROT
O08734 
Uniprot/SPTREMBL
Q91WX5 Q91ZT2 Q8C264 
Human Ortholog
ENSG00000030110 (BAK1)
Omim not available
UniTrap UNI19982
Vector Insertion
Chr 17: 27162839 - 27165355
Public Clones IST14197C8 (tigm) IST14553B4 (tigm) IST10114C5 (tigm)
Private Clones OST375955 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI22567
Vector Insertion
Chr 17: 27157981 - 27158111
Public Clones not available
Private Clones OST291523 (lexicon) OST36075 (lexicon)
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000025034
Sequence
CCTGGGCCAAGAGGCAACCCGAGGCGGCATCCAGCACCATGAATCCACTGATACCAGTTCCTGCCAGTCAGGCCTGAAACCTTGGCCCCTGGAAGCAGCC

AGCAAGCCCTTCGGGGTCTTCGTCTTTGCACGGCTGAGCCATCCCACATCTGGAGCAGAGTCATTCAG - UNI19982 - GTGACAAGTGACGGTGGT

CTCCACCAAGACCTGAAAAATGGCATCTGGACAAGGACCAGGTCCCCCGAAGGTGGGCTGCGATGAGTCCCCGTCCCCTTCTG AACAGCAGGTTGCCCA

GGACACAGAGGAGGTCTTTCGAAGCTACGTTTTTTACCTCCACCAGCAGGAACAGGAGACCCAGGGGGCGGCCGCCCCTGCCAACCCCGAGATGGACAAC

TTGCCCCTGGAACCCAACAG CATCTTGGGTCAGGTGGGTCGGCAGCTTGCTCTCATCGGAGATGATATTAACCGGCGCTACGACACAGAGTTCCAGAAT

TTACTAGAACAGCTTCAGCCCACAGCCGGGAATGCCTACGAACTCTTCACCAAGATCGCCTCCAG GCCAGCAGCAACATGCACAG CCTATTTAAGAGT

GGCATCAGCTGGGGCCGCGTGGTGGCTCTCCTGGGCTTTGGCTACCGTCTGGCCCTGTACGTCTACCAGCGTGGTTTGACCGGCTTCCTGGGCCAGGTGA

CCTGCTTTTTGGCTGATATCATACTGCATCATTACATCGCCAGATGGATCGCACAGAGAGGCGGTTGG - UNI22567 - GTGGCAGCCCTGAATTTT

CGTAGAGACCCCATCCTGACCGTAATGGTGATTTTTGGTGTGGTTCTGTTGGGCCAATTCGTGGTACACAGATTCTTCAGATCATGACTCCCGGGGAGCC

CCACTGGGGCCCCAGCCACGTGCCTGGCTGGACTAAACCTCTCTCCCTACCCCACCCCCTACCCCCCACCCCAACAGTCCTCTCCTTCCTCCCCAGGGCA

AAGACGCTTTAGCAAACAGGCACCCCTGATTTGGAGAGCCACCGCCCAGGGGTCATCAATACCCCAACATTGCATGGTGCTACTGAACCCCATCCTGTCT

CAGAGGCACTGACTGACGCACTGGGGGGGGTGGGTGGGGGATGGAGAGGCTGGGCCACTAATTCCCAGAAAACTAGGTTTGTTTTTATACTACCCTTTAG

ATACAATCCACCCTTTTTCTCCACTGTGCCCAAAGTCAGAACATGGAGGGCTTGGGGACTGGTGGTTCGAACCTGTGTTCCCAACACTCCTGCTACTTTG

GAAGGTCAGCCCTTGAGAAGAGACCTGAGCACAATCCTTGCCCTCCCTACATTGGCTCCCAAGACCAACTGTAGGAGACTGCATGACCTACTTCACCCCC

ACCTCATCGTCCATTTCCCCAACCCTACCCCCCACACCCCCTCCCCTCCTATCTCCTACCCCAATCCATCCATTTTTGCCTTGGCGGCTGGACTCTCAGG

GATTCTGAGCCCAGAGTGAGGGCAGAGGTGAGAGTTCAGACCACAGCTGTCTGAACACATCCATCAGGCTCTCCAATCCTGTGTCCTTCCTGACCCGTGC

TCCCAACCTAGTGGGTAGGGGAAGACGCCACTTTCTCCCCAGGGCTCTCAGGTGAGCCTGCCTGCTGGGGCGGAGGCCTTCCTGACAGACGGACGGACAG

AGCCTCAGACTCAGCCACTATGACAGGGGAGGGGGTGGGCACTCTTTGGAGGTGTCCACACTAGAGAACTACTCCAGCAGAAGCAACTGTGGACCTGGGT

GCAGTTCCTCCCCGGAACCTATGATTACTTGAACCCCACCTTCACTCCTTGTCTGCCTAGGTCCTCCTCGGGTTGGGTGGGGTGGGTGTTTTTCTCTGTC

TTGCACAACATAGGGGTGAGAAGTTTTGATTAAGCCAAATGTATCGGGGAAGAGGGGGAGGCAGAGGGTGCTCTGTGTCTGGAAATAAACTGTGCAATGC

CCCC
Translation
 - UNI19982 - MASGQGPGPPKVGCDESPSPSE EQQVAQDTEEVFRSYVFYLHQQEQETQGAAAPANPEMDNLPLEPNS SILGQVGRQLALIGDD

INRRYDTEFQNLLEQLQPTAGNAYELFTKIASR RPAATCTA AYLRVASAGAAWWLSWALATVWPCTSTSVV - UNI22567 - 
Transcript ENSMUST00000078691
Sequence
ATTGCCGGGAGCTGGGACCTCCTCTATGGTCACAAAGTCGCGAGGTTTCCTGGGCCAAGAGGCAACCCGAGGCGGCATCCAGCACCATGAATCCACTGAT

ACCAGTTCCTGCCAGTCAGGCCTGAAACCTTGGCCCCTGGAAGCAGCCAGCAAGCCCTTCGGGGTCTTCGTCTTTGCACGGCTGAGCCATCCCACATCTG

GAGCAGAGTCATTCAG - UNI19982 - GTGACAAGTGACGGTGGTCTCCACCAAGACCTGAAAAATGGCATCTGGACAAGGACCAGGTCCCCCGAAG

GTGGGCTGCGATGAGTCCCCGTCCCCTTCTG AACAGCAGGTTGCCCAGGACACAGAGGAGGTCTTTCGAAGCTACGTTTTTTACCTCCACCAGCAGGAA

CAGGAGACCCAGGGGGCGGCCGCCCCTGCCAACCCCGAGATGGACAACTTGCCCCTGGAACCCAACAG CATCTTGGGTCAGGTGGGTCGGCAGCTTGCT

CTCATCGGAGATGATATTAACCGGCGCTACGACACAGAGTTCCAGAATTTACTAGAACAGCTTCAGCCCACAGCCGGGAATGCCTACGAACTCTTCACCA

AGATCGCCTCCAG CCTATTTAAGAGTGGCATCAGCTGGGGCCGCGTGGTGGCTCTCCTGGGCTTTGGCTACCGTCTGGCCCTGTACGTCTACCAGCGTG

GTTTGACCGGCTTCCTGGGCCAGGTGACCTGCTTTTTGGCTGATATCATACTGCATCATTACATCGCCAGATGGATCGCACAGAGAGGCGGTTGG - UN

I22567 - GTGGCAGCCCTGAATTTTCGTAGAGACCCCATCCTGACCGTAATGGTGATTTTTGGTGTGGTTCTGTTGGGCCAATTCGTGGTACACAGAT

TCTTCAGATCATGACTCCCGGGGAGCCCCACTGGGGCCCCAGCCACGTGCCTGGCTGGACTAAACCTCTCTCCCTACCCCACCCCCTACCCCCCACCCCA

ACAGTCCTCTCCTTCCTCCCCAGGGCAAAGACGCTTTAGCAAACAGGCACCCCTGATTTGGAGAGCCACCGCCCAGGGGTCATCAATACCCCAACATTGC

ATGGTGCTACTGAACCCCATCCTGTCTCAGAGGCACTGACTGACGCACTGGGGGGGGTGGGTGGGGGATGGAGAGGCTGGGCCACTAATTCCCAGAAAAC

TAGGTTTGTTTTTATACTACCCTTTAGATACAATCCACCCTTTTTCTCCACTGTGCCCAAAGTCAGAACATGGAGGGCTTGGGGACTGGTGGTTCGAACC

TGTGTTCCCAACACTCCTGCTACTTTGGAAGGTCAGCCCTTGAGAAGAGACCTGAGCACAATCCTTGCCCTCCCTACATTGGCTCCCAAGACCAACTGTA

GGAGACTGCATGACCTACTTCACCCCCACCTCATCGTCCATTTCCCCAACCCTACCCCCCACACCCCCTCCCCTCCTATCTCCTACCCCAATCCATCCAT

TTTTGCCTTGGCGGCTGGACTCTCAGGGATTCTGAGCCCAGAGTGAGGGCAGAGGTGAGAGTTCAGACCACAGCTGTCTGAACACATCCATCAGGCTCTC

CAATCCTGTGTCCTTCCTGACCCGTGCTCCCAACCTAGTGGGTAGGGGAAGACGCCACTTTCTCCCCAGGGCTCTCAGGTGAGCCTGCCTGCTGGGGCGG

AGGCCTTCCTGACAGACGGACGGACAGAGCCTCAGACTCAGCCACTATGACAGGGGAGGGGGTGGGCACTCTTTGGAGGTGTCCACACTAGAGAACTACT

CCAGCAGAAGCAACTGTGGACCTGGGTGCAGTTCCTCCCCGGAACCTATGATTACTTGAACCCCACCTTCACTCCTTGTCTGCCTAGGTCCTCCTCGGGT

TGGGTGGGGTGGGTGTTTTTCTCTGTCTTGCACAACATAGGGGTGAGAAGTTTTGATTAAGCCAAATGTATCGGGGAAGAGGGGGAGGCAGAGGGTGCTC

TGTGTCTGGAAATAAACTGTGCAATGCCCCC
Translation
 - UNI19982 - MASGQGPGPPKVGCDESPSPSE EQQVAQDTEEVFRSYVFYLHQQEQETQGAAAPANPEMDNLPLEPNS SILGQVGRQLALIGDD

INRRYDTEFQNLLEQLQPTAGNAYELFTKIASS SLFKSGISWGRVVALLGFGYRLALYVYQRGLTGFLGQVTCFLADIILHHYIARWIAQRGGW - UN

I22567 - VAALNFRRDPILTVMVIFGVVLLGQFVVHRFFRS

For any suggestions or comments, please send an email to unitrap@crg.es