Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000057895 (Zfp105)
Chromosomal location
Chr 9: 122832196 - 122840146 (+)
Description
zinc finger protein 105 Gene [Source:MGI (curated);Acc:Zfp105-001]
RefSeq_dna
NM_009544 
RefSeq_peptide
NP_033570.2 
UniGene
Mm.290595 
MGI
MGI:1277119 
Uniprot/SPTREMBL
O88412 Q3UHV1 Q80WR2 
Human Ortholog
ENSG00000169981 (ZNF35)
Omim not available
UniTrap UNI20980
Vector Insertion
Chr 9: 122832337 - 122834125
Public Clones (sanger)
Private Clones OST346798 (lexicon) OST91564 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI8804
Vector Insertion
Chr 9: 122835573 - 122838717
Public Clones TEA059 (baygenomics) A055A07 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 21% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000051667
Sequence
CTCAGCCCCGTTGCTGCCGAGAGACTCTGGAGTCTCATCCGCGAAGCGGCACCGGCCCGGTTGGGCCTTCGTGGCGAGCCGGTCGCAGCGGGCGGCGAGG

GGCGCGGGACTGTTCTCCACCGACCATCGCGGGGCCGGGAG - UNI20980 - TGAATAGCTCATCTTGGCTCTGGAGACTTGAAGGTTAGATGGAGC

TTGACCGATGTTGGGTATCCCTCAGCTATCAAGGATCCTGCATTGAACAGAGAAGATGACTACAGAATTGAAAGAGACCATGGGCAGAGCCTCTTGGGAC

CCAGAGAAGGTGAAAATGGAAGAAGATGATGAAAGTGTCATAAGTCAGGCATCCAGCCAACAAGTGTACTATGAGAACGACAAGGACTGTGCCCCAGGGG

AGGGTCCTTATGGAAGCATCAGTGTATCAGAAGATGAGGAAAAG GGTCAGGAAATGTTCCGGGAAATGGCAGTGGTGCTAAAAGCAACACAGGAGGCTG

CTGCTGCTTCACCCTTTGGGAGCTACTCGTTGGCAGGGACTCTGGCCGAGAGTCAAATCCTGGAGCTTCATGGGAACCCAACCCCAACAG - UNI8804

 - GTGCCAAAAGCAAGAACCTAGAGTTATTGATTCCTAAAAAGGAGATAAGTGATGACTCGGAGAAGCCCCCCATGATTTTAGGAAGAATCCAGAAAGG

TGACCTTCAAGGACCTGAGTTAGGAGAATCTTGTGAAAAGGGAAATGTGTTAAAAGGGCTGAGGATAAAGGAGGAAAAGGGAGATTTGGGAGAAGCAACA

GTGAAAGACTGTCCATTGTCTGAAAGCTTCCGAGACGAGGAAGAATCCAAGAAGTCTAGGGGGAAATACAGCCTCAGATCTACTCCTGGTAAAAATCAGA

AAATACAGCCCGGGCAAAAACCGTTTACATGTAGTGAGTGTGGGAAAGGCTTTAGTCAGAGTGCAAATCTTGTTGTGCATCAACGAATCCACACTGGGGA

GAAGCCCTTCGAGTGTCATGAGTGTGGGAAGGCCTTCATTCAAAGTGCAAACCTCGTTGTGCATCAGAGGATCCACACTGGACAGAAACCCTATGTCTGT

GGAAAATGTGGGAAGGCTTTCACTCAGAGTTCAAATCTGACTGTCCATCAGAAAATCCACTCCTTAGAAAAAACCTTTAAGTGTAGTGAATGTGAGAAAG

CCTTCAGTTACAGCTCGCAACTTGCTCGGCACCAGAAAGTCCATATAACCGAGAAATGCTATGAATGCAATGAGTGTGGAAAAACCTTCACTCGAAGCTC

CAACCTCATCGTCCATCAGAGAATCCACACTGGGGAGAAGCCTTTCGCCTGCAGTGACTGTGGCAAAGCCTTTACTCAGAGTGCAAATCTTATTGTGCAT

CAGAGAAGCCACACTGGTGAGAAGCCGTATAAGTGTAAAGACTGTGAAAAAGCCTTCAGTTGTTTTTCTCACCTTATTGTGCACCAGAGAATTCACACTG

CAGAGAAACCTTATGACTGCAGCGAATGTGGGAAAGCCTTTAGTCAGCTATCTTGCCTTATTGTCCACCAGAGAATTCATAGTGGAGATCTCCCTTATGT

GTGTAATGAGTGTGGGAAGGCCTTCACTTGTAGCTCATACCTACTCATTCATCAAAGAATCCATAATGGGGAAAAGCCTTATTCGTGTAATGAGTGTGGG

AAGGCCTTCAGACAGAGGTCGAGCCTCACTGTCCACCAGCGAACCCACACAGGAGAGAAGCCCTATGAATGTGCAAAGTGTGGTGCAGCTTTTATTTCTA

ACTCACACCTCATGAGACATCACAGAACCCATCTTGTTGAATAGCAAGGAAGAGTACGATGCCCTGCTTTTGGTCATAACCTACTGCTCCTAATAGTAGG

CACTTCTGTTCTTTATTCTTCCTTTGACAAAATGAGGACTATACCCTTTAAAGTTATTTTTCTGGAAGGTAATGTAAACACACATTCAGAGGCTAATTTA

AAGAAAATAAAACTTAAACACCTAAAAGCCAA
Translation
 - UNI20980 - MTTELKETMGRASWDPEKVKMEEDDESVISQASSQQVYYENDKDCAPGEGPYGSISVSEDEEK GQEMFREMAVVLKATQEAAAAS

PFGSYSLAGTLAESQILELHGNPTPTG - UNI8804 - GAKSKNLELLIPKKEISDDSEKPPMILGRIQKGDLQGPELGESCEKGNVLKGLRIKEEKG

DLGEATVKDCPLSESFRDEEESKKSRGKYSLRSTPGKNQKIQPGQKPFTCSECGKGFSQSANLVVHQRIHTGEKPFECHECGKAFIQSANLVVHQRIHTG

QKPYVCGKCGKAFTQSSNLTVHQKIHSLEKTFKCSECEKAFSYSSQLARHQKVHITEKCYECNECGKTFTRSSNLIVHQRIHTGEKPFACSDCGKAFTQS

ANLIVHQRSHTGEKPYKCKDCEKAFSCFSHLIVHQRIHTAEKPYDCSECGKAFSQLSCLIVHQRIHSGDLPYVCNECGKAFTCSSYLLIHQRIHNGEKPY

SCNECGKAFRQRSSLTVHQRTHTGEKPYECAKCGAAFISNSHLMRHHRTHLVE

For any suggestions or comments, please send an email to unitrap@crg.es