Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000058046 (4933430I17Rik)
Chromosomal location
Chr 4: 62186403 - 62209027 (+)
Description
RIKEN cDNA 4933430I17 gene Gene [Source:MGI Symbol;Acc:MGI:3045314]
RefSeq_dna
NM_177607 
RefSeq_peptide
NP_808275.1 
UniGene
Mm.73212 
MGI
MGI:3045314 
Uniprot/SPTREMBL
Q14AX1 Q8BHW4 
Human Ortholog
ENSG00000157653 (C9orf43)
Omim not available
UniTrap UNI25146
Vector Insertion
Chr 4: 62186913 - 62193285
Public Clones IST14775E4 (tigm)
Private Clones OST193952 (lexicon)
Severity of mutation (?) Insertion after 4% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000062145
Sequence
GTGTGGCCTGGTGCCTAGCTTGGAAAGG GACAGCAGTAACAAGGGCAATATCAAAAGACGCCTGATGAGACTTCGGAGCTCAATTTGGTCTGGTTCGGT

ACTGAAAGCGCAAGAATCATTTGATT - UNI25146 - CTATGAACGTGGCAGATGAGTCCCAGTGGGACGAAGCCGTTTGTACCTTGTCAGGTTGTC

AGCATCCACAGTGCTGGGCATCTCTCCGACGGATTGAGAGGGGCCATCCTAGGATCCTGGACCCATCCCCCAAATCTCCCAGAGAAACTGAAG ATAAAC

TCCCGACACTCACCATTGTAAACATCACGGATACCTGCTTGTGGACCCAGAAGAGGGTGGCTCAGCAACAACCATCAGAATTTACCTTCCCCAAAGATCG

TCCCTCATTGTCGAAGCCAGCCTCCAAACGTCAGAGCAG GTCTCCGAAGGCTTTACGTGACAAAGATGTGACTAGCCGTTCTCCTAGGCCTCTCAAA C

TCTCAGTGTTGAATTTGAATGAAGCAAAACTTCCTCTCTCTGAAAATGTCAGTAACATGGTTGTGACCTGGGTTCCAGAAGAAACGGAGAAGGACGTGAG

 CCCAGTTCAAAAGACTGATGTTTCCAGCTGGCCTGGGAAGAAAAGGAGAAAGAAACTGCGAAAG AAAAGCAAGCCATCTCTGTACTACCCTGGAAGGC

AGTACTCGAGAAGTCCAGCGGCAATTGTACCTCCCCCCTCCCCAGAACACCACTTGGAGCAATTAAGTCCTGAAGCCATACCACTATGGGCTCAAGTTGG

CATGCTTCCCCAGGACCTGCTGGAGGAGTG CATCTTGGCACATGAGAAATCCATAATTGGCCCTGAGGTGAAGATAGAGTTGTCCAAGATGAGAAAGAG

TCTTCCTCTGGAAAGGAGGCGACCTGAAAGTGCTATCTCATCTAAGATGTATCTGACTATCCAACGCCTCACCCTGCAA AGACCATCACTGCGGTATCC

TGCTCGTCTGAGGAAGCTTTGCCCCAACCTGAAGCAAGGTGAGGGCCTTGCTGGGCATGGATCTTCAG ATTCCTTGATGCAGCAGGGGAAGGCGAAAAC

CTTTCCTCCGAAACAG GAGCCTAAGAAGAAAGCCAAGAGAAATGTCAAGGGCCAGTATG GGGAAGAAACCACGTCGGGCCATTTCTTCCATGACAGTG

TAGGACTCAGAATATCAGGACAGGAAGATCAACAAACGCCGTGGGAAGAAGAGGACATAGAGAAAACATCTGCAGAGACACAT GTTTCCTTAGAAGAAG

TGTATGAGTTTGACAAGTACTACACAGAATACTACGCCACTCCGGAGA GCGCTGTACTATATGAGACAGTTTACCAGAACCTTGATGATGACGAGGAGA

CTATGGTGGGAATCAAGGCTTCCAGCAAAGACCGTAACCTCAAGAACCTTTCTGCAATGATGGACGGCATCGGCTGGAACCCTGAGCTCAAATTGCTGAG

GATTCTTCAGGCCACTGAGGAGGAAGATGAGGAAGGCCATAATTCTAGGGCACAGAGTAAGACGTCTCTAGAAGCTTAGCTCAAATCATCACTTTGGGCA

GCTTTAGCCAGAGAGTTCTTGGTATTCTGAGGACAACAACCTTGGACACAGGGAAGAAAAGAGAGAATGTTGTTCTCTGGATCCTCCAGCAGGACCAGGC

CCTAGATACCCTGTATTCTTCATTTACTCTTTACCTCCAAAACGAGTAAGAAAAAGCCCTAATCCTATGGAATATAGGCAGCTTTTCCATCATTAAACAC

AACTCCTTCT
Translation
 MRLRSSIWSGSVLKAQESFDS - UNI25146 - SMNVADESQWDEAVCTLSGCQHPQCWASLRRIERGHPRILDPSPKSPRETED DKLPTLTIVNI

TDTCLWTQKRVAQQQPSEFTFPKDRPSLSKPASKRQSR RSPKALRDKDVTSRSPRPLK LSVLNLNEAKLPLSENVSNMVVTWVPEETEKDVS SPVQK

TDVSSWPGKKRRKKLRK KSKPSLYYPGRQYSRSPAAIVPPPSPEHHLEQLSPEAIPLWAQVGMLPQDLLEEC CILAHEKSIIGPEVKIELSKMRKSLP

LERRRPESAISSKMYLTIQRLTLQ RPSLRYPARLRKLCPNLKQGEGLAGHGSSD DSLMQQGKAKTFPPKQ EPKKKAKRNVKGQYG GEETTSGHFFH

DSVGLRISGQEDQQTPWEEEDIEKTSAETH VSLEEVYEFDKYYTEYYATPES SAVLYETVYQNLDDDEETMVGIKASSKDRNLKNLSAMMDGIGWNPE

LKLLRILQATEEEDEEGHNSRAQSKTSLEA

For any suggestions or comments, please send an email to unitrap@crg.es