Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000058240 (Cryzl1)
Chromosomal location
Chr 16: 91689587 - 91729047 (-)
Description
crystallin, zeta (quinone reductase)-like 1 Gene [Source:MGI (curated);Acc:Cryzl1-003]
RefSeq_dna
NM_133679 
RefSeq_peptide
NP_598440.1 
UniGene
Mm.399230 Mm.468265 
MGI
MGI:1913859 
Uniprot/SWISSPROT
Q921W4 
Human Ortholog
ENSG00000205758 (CRYZL1)
Omim not available
UniTrap UNI22700
Vector Insertion
Chr 16: 91717721 - 91728802
Public Clones (sanger) D134C10 (ggtc) IST14439G2 (tigm) IST14158G12 (tigm) IST14992G4 (tigm)
IST14874E7 (tigm) IST14398A5 (tigm)
Private Clones OST287475 (lexicon) OST257633 (lexicon) OST40388 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI4610
Vector Insertion
Chr 16: 91717648 - 91717721
Public Clones AW0826 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI19659
Vector Insertion
Chr 16: 91712513 - 91714993
Public Clones not available
Private Clones OST384592 (lexicon) OST301293 (lexicon) OST262957 (lexicon) OST203797 (lexicon)
OST184141 (lexicon) OST182965 (lexicon)
Severity of mutation (?) Insertion after 14% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI24932
Vector Insertion
Chr 16: 91709119 - 91712439
Public Clones not available
Private Clones OST200663 (lexicon)
Severity of mutation (?) Insertion after 22% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI28513
Vector Insertion
Chr 16: 91689586 - 91690161
Public Clones not available
Private Clones OST29153 (lexicon)
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000114023
Sequence
GCTCTCTGCAGAAGGACTGGGAAGGTGGCGGCGGCGAAGGCGCTGGCGGTTGAGGTTGCTCCGAGCCAG - UNI4610 - - UNI22700 - GTAAC

TATGAAAGGCTTGTATTTTCAACAGAGTTCTACAAATGAAGAAGTAACATTTGTATTTCAAGAAAAG - UNI4610 - GAAAATGTCCCTGTCACAGA

GGATAACTTTGTGAGAGTTCAAGTTAAAGCTTGTGCCCTGAGCCACATAAACACAAAG - UNI19659 - CTTCTAGCAGAAATGAAGATGGAAAAGG

ATTTCTTCCCTGTTGGAAGAGAAGTTTCTGGAATTGTATTAGAGG - UNI24932 - TTGGCAGGAAGGTAACGTTCTTTCAGCCAGACGACGAAGTG

GTCG GAATTCTGCCTTTGGATTCCGAAGACCCCGGGCTCTGTGAGGTTATTCGAGTACATGAGCATTACCTGG TTCATAAGCCAGAAAAGGTGTCATG

GACGGAAGCTGCTGGCGTCATCCGGGACGGAGTCCGAGCCTGCACAGCTCTGTATTATCTTTCTCAACTCTCTCCTGGAAAGTCTGTGCTGATCATGGAC

GGGGCAAGT GCATTTGGCACAATAGCCATTCAGTTAGCCCACCACAGAGGAGCCAAGGTTATCTCAACAGCACACAGCCTGGAGGACAAGCAACATCTT

GAAAGGCTTAGGCCTTCTATAG CCCGTGTGATTGATGTGTCTAATGGGAAAGTCCATGTTGCTGAAAGCTGTTTGGAGGAAACAGGTGGCCTGGGAGTA

GATATTGTCATAGATGCAGGAG GATTGGAAGCTGACGTATGA
Translation
 - UNI4610 - - UNI22700 - MKGLYFQQSSTNEEVTFVFQEK - UNI4610 - ENVPVTEDNFVRVQVKACALSHINTK - UNI19659 -

 LLAEMKMEKDFFPVGREVSGIVLEV - UNI24932 - VGRKVTFFQPDDEVVG GILPLDSEDPGLCEVIRVHEHYLV VHKPEKVSWTEAAGVIRD

GVRACTALYYLSQLSPGKSVLIMDGAS AFGTIAIQLAHHRGAKVISTAHSLEDKQHLERLRPSIA ARVIDVSNGKVHVAESCLEETGGLGVDIVIDAG

G GLEADV
Transcript ENSMUST00000117644
Sequence
TTTATTGGTGGTCCCTGGGGCGGCGACTCGTCTCTCTACGGGAAGCAGCATGCTGGGAGATGTAGTTCCGGGTTCAGTTGCCATGGCGTTCGTCACAGCC

TCCCCCAGATCGGTCATCCTGCGGTAGTGACGGGCAGTCTGACCAATGGCAGTACTGTTTGGACCCAAGAAGGCGGGCTCTCTGCAGAAGGACTGGGAAG

GTGGCGGCGGCGAAGGCGCTGGCGGTTGAGGTTGCTCCGAGCCAG - UNI4610 - - UNI22700 - GTAACTATGAAAGGCTTGTATTTTCAACA

GAGTTCTACAAATGAAGAAGTAACATTTGTATTTCAAGAAAAG - UNI4610 - GAAAATGTCCCTGTCACAGAGGATAACTTTGTGAGAGTTCAAGT

TAAAGCTTGTGCCCTGAGCCACATAAACACAAAG - UNI19659 - CTTCTAGCAGAAATGAAGATGGAAAAGGATTTCTTCCCTGTTGGAAGAGAAG

TTTCTGGAATTGTATTAGAGG - UNI24932 - GAATTCTGCCTTTGGATTCCGAAGACCCCGGGCTCTGTGAGGTTATTCGAGTACATGAGCATTAC

CTGG TTCATAAGCCAGAAAAGGTGTCATGGACGGAAGCTGCTGGCGTCATCCGGGACGGAGTCCGAGCCTGCACAGCTCTGTATTATCTTTCTCAACTC

TCTCCTGGAAAGTCTGTGCTGATCATGGACGGGGCAAGT GCATTTGGCACAATAGCCATTCAGTTAGCCCACCACAGAGGAGCCAAGGTTATCTCAACA

GCACACAGCCTGGAGGACAAGCAACATCTTGAAAGGCTTAGGCCTTCTATAG CCCGTGTGATTGATGTGTCTAATGGGAAAGTCCATGTTGCTGAAAGC

TGTTTGGAGGAAACAGGTGGCCTGGGAGTAGATATTGTCATAGATGCAGGAG TGAGATTATATAGTAAAGATGATGAACCAGCTGTAAAGTTACATCTG

CCACATAAGCATGACATCATCACACTTCTTGGTGTCGGAGGCCATTGGGTAACAACAGAAGAAAACCTTCAG TTGGATCCTCCAGATAGCCACTGCCTT

TTCCTCAAGGGAGCAACGGTGGCTTTCCTTAATGATGAAGTTTGGAATTTGTCAAATGCACAACAGGGAAAATATCTTT GTATCTTAAAAGATGTGATG

GAGAAGTTATCAGCTGGTGTTTTCAG - UNI28513 - GCCTCTGCTCGATGAGCCCATCCCACTGTATGAGGCAAAGGTTTCCATGGAAGTTGTTCA

GAAAAATCAAGAAAGAAAAAAGCAAGTCGTTCAATTTTAATTCTCTTCCCTGATCTCAGTCGGATGCACCCACACCAGTGGGGGAAGCCAGTTTTCTTTG

GAAATTGTTGAGAAAAACCAAGGACGATAAAGCAAGATTTTATATTTTTAAGCCTGTTTTCCTGCCACAGTAAGATGTTTGGTTATTTGACATATTTGAA

AAATACTTCCAAAATTAATGTGCAAACAATCCAGATAATTTTTTTACCATCTGAAGGGGACATTCCAAAAGCTTCTTTTAGTTATTGTATCTGTACACTT

TGCCTCTGCTATAAAATTCTTTCCATTAAGAAAACTGCTTTCAGCAAAAGCTACACTATTCTAGCAAATACATCTGTCACATGCTTTTGCTATACCAAAC

GTCATTTGATTTTGTTATCAACTTCATTCTCAACACCTTCCTTAACAAACCGTTGATGCCATTATTTTAGCATTTGTACTTTCCGACTTCAAAGTATCTA

ATCCACTGGCATTT
Translation
 - UNI4610 - - UNI22700 - MKGLYFQQSSTNEEVTFVFQEK - UNI4610 - ENVPVTEDNFVRVQVKACALSHINTK - UNI19659 -

 LLAEMKMEKDFFPVGREVSGIVLEG - UNI24932 - GILPLDSEDPGLCEVIRVHEHYLV VHKPEKVSWTEAAGVIRDGVRACTALYYLSQLSPG

KSVLIMDGAS AFGTIAIQLAHHRGAKVISTAHSLEDKQHLERLRPSIA ARVIDVSNGKVHVAESCLEETGGLGVDIVIDAGV VRLYSKDDEPAVKLH

LPHKHDIITLLGVGGHWVTTEENLQ LDPPDSHCLFLKGATVAFLNDEVWNLSNAQQGKYLC CILKDVMEKLSAGVFR - UNI28513 - RPLLDEP

IPLYEAKVSMEVVQKNQERKKQVVQF
Transcript ENSMUST00000073466
Sequence
GCTCTCTGCAGAAGGACTGGGAAGGTGGCGGCGGCGAAGGCGCTGGCGGTTGAGGTTGCTCCGAGCCAG - UNI4610 - - UNI22700 - GTAAC

TATGAAAGGCTTGTATTTTCAACAGAGTTCTACAAATGAAGAAGTAACATTTGTATTTCAAGAAAAG - UNI4610 - GAAAATGTCCCTGTCACAGA

GGATAACTTTGTGAGAGTTCAAGTTAAAGCTTGTGCCCTGAGCCACATAAACACAAAG - UNI19659 - CTTCTAGCAGAAATGAAGATGGAAAAGG

ATTTCTTCCCTGTTGGAAGAGAAGTTTCTGGAATTGTATTAGAGG - UNI24932 - TTGGCAGGAAGGTAACGTTCTTTCAGCCAGACGACGAAGTG

GTCG GAATTCTGCCTTTGGATTCCGAAGACCCCGGGCTCTGTGAGGTTATTCGAGTACATGAGCATTACCTGG TTCATAAGCCAGAAAAGGTGTCATG

GACGGAAGCTGCTGGCGTCATCCGGGACGGAGTCCGAGCCTGCACAGCTCTGTATTATCTTTCTCAACTCTCTCCTGGAAAGTCTGTGCTGATCATGGAC

GGGGCAAGT GCATTTGGCACAATAGCCATTCAGTTAGCCCACCACAGAGGAGCCAAGGTTATCTCAACAGCACACAGCCTGGAGGACAAGCAACATCTT

GAAAGGCTTAGGCCTTCTATAG CCCGTGTGATTGATGTGTCTAATGGGAAAGTCCATGTTGCTGAAAGCTGTTTGGAGGAAACAGGTGGCCTGGGAGTA

GATATTGTCATAGATGCAGGAG TGAGATTATATAGTAAAGATGATGAACCAGCTGTAAAGTTACATCTGCCACATAAGCATGACATCATCACACTTCTT

GGTGTCGGAGGCCATTGGGTAACAACAGAAGAAAACCTTCAG TTGGATCCTCCAGATAGCCACTGCCTTTTCCTCAAGGGAGCAACGGTGGCTTTCCTT

AATGATGAAGTTTGGAATTTGTCAAATGCACAACAGGGAAAATATCTTT GTATCTTAAAAGATGTGATGGAGAAGTTATCAGCTGGTGTTTTCAG - U

NI28513 - GCCTCTGCTCGATGAGCCCATCCCACTGTATGAGGCAAAGGTTTCCATGGAAGTTGTTCAGAAAAATCAAGAAAGAAAAAAGCAAGTCGT

TCAATTTTAATTCTCTTCCCTGATCTCAGTCGGATGCACCCACACCAGTGGGGGAAGCCAGTTTTCTTTGGAAATTGTTGAGAAAAACCAAGGACGATAA

AGCAAGATTTTATATTTTTAAGCCTGTTTTCCTGCCACAGTAAGATGTTTGGTTATTTGACATATTTGAAAAATACTTCCAAAATTAATGTGCAAACAAT

CCAGATAATTTTTTTACCATCTGAAGGGGACATTCCAAAAGCTTCTTTTAGTTATTGTATCTGTACACTTTGCCTCTGCTATAAAATTCTTTCCATTAAG

AAAACTGCTTTCAGCAAAAGCTACACTATTCTAGCAAATACATCTGTCACATGCTTTTGCTATACC
Translation
 - UNI4610 - - UNI22700 - MKGLYFQQSSTNEEVTFVFQEK - UNI4610 - ENVPVTEDNFVRVQVKACALSHINTK - UNI19659 -

 LLAEMKMEKDFFPVGREVSGIVLEV - UNI24932 - VGRKVTFFQPDDEVVG GILPLDSEDPGLCEVIRVHEHYLV VHKPEKVSWTEAAGVIRD

GVRACTALYYLSQLSPGKSVLIMDGAS AFGTIAIQLAHHRGAKVISTAHSLEDKQHLERLRPSIA ARVIDVSNGKVHVAESCLEETGGLGVDIVIDAG

V VRLYSKDDEPAVKLHLPHKHDIITLLGVGGHWVTTEENLQ LDPPDSHCLFLKGATVAFLNDEVWNLSNAQQGKYLC CILKDVMEKLSAGVFR - U

NI28513 - RPLLDEPIPLYEAKVSMEVVQKNQERKKQVVQF
Transcript ENSMUST00000122254
Sequence
CTCTGCAGAAGGACTGGGAAGGTGGCGGCGGCGAAGGCGCTGGCGGTTGAGGTTGCTCCGAGCCAG - UNI4610 - - UNI22700 - GTAACTAT

GAAAGGCTTGTATTTTCAACAGAGTTCTACAAATGAAGAAGTAACATTTGTATTTCAAGAAAAG - UNI4610 - GAAAATGTCCCTGTCACAGAGGA

TAACTTTGTGAGAGTTCAAGTTAAAGCTTGTGCCCTGAGCCACATAAACACAAAG - UNI19659 - CTTCTAGCAGAAATGAAGATGGAAAAGGATT

TCTTCCCTGTTGGAAGAGAAGTTTCTGGAATTGTATTAGAGG - UNI24932 - TTCATAAGCCAGAAAAGGTGTCATGGACGGAAGCTGCTGGCGTC

ATCCGGGACGGAGTCCGAGCCTGCACAGCTCTGTATTATCTTTCTCAACTCTCTCCTGGAAAGTCTGTGCTGATCATGGACGGGGCAAGT GCATTTGGC

ACAATAGCCATTCAGTTAGCCCACCACAGAGGAGCCAAGGTTATCTCAACAGCACACAGCCTGGAGGACAAGCAACATCTTGAAAGGCTTAGGCCTTCTA

TAG - UNI28513 - GCCTCTGCTCGATGAGCCCATCCCACTGTATGAGGCAAAGGTTTCCATGGAAGTTGTTCAGAAAAATCAAGAAAGAAAAAAGC

AAGTCGTTCAATTTTAATTCTCTTCCCTGATCTCAGTCGGATGCACCCACACCAGTGGGGGAAGCCAGTTTTCTTTGGAAATTGTTGAGAAAAACCAAGG

ACGATAAAGCAAGATTTTATATTTTTAAGCCTGTTTTCCTGCCACAGTAAGATGTTTGGTTATTTGACATATTTGAAAAATACTTCCAAAATTAATGTGC

AAACAATCCAGATAATTTTTTTACCAT
Translation
 - UNI4610 - - UNI22700 - MKGLYFQQSSTNEEVTFVFQEK - UNI4610 - ENVPVTEDNFVRVQVKACALSHINTK - UNI19659 -

 LLAEMKMEKDFFPVGREVSGIVLEV - UNI24932 - VHKPEKVSWTEAAGVIRDGVRACTALYYLSQLSPGKSVLIMDGAS AFGTIAIQLAHHRG

AKVISTAHSLEDKQHLERLRPSIG - UNI28513 - GLCSMSPSHCMRQRFPWKLFRKIKKEKSKSFNFNSLP

For any suggestions or comments, please send an email to unitrap@crg.es