Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000058301 (Upf1)
Chromosomal location
Chr 8: 72855432 - 72877178 (-)
Description
UPF1 regulator of nonsense transcripts homolog (yeast) Gene [Source:MGI Symbol;Acc:MGI:107995]
RefSeq_peptide
NP_109605.2 NP_001116301.1 
UniGene
Mm.390048 
MGI
MGI:107995 
Uniprot/SWISSPROT
Q9EPU0 
Human Ortholog
ENSG00000005007 (UPF1)
Omim not available
UniTrap UNI2625
Vector Insertion
Chr 8: 72868265 - 72876676
Public Clones XR0413 (sanger) FHCRC-GT-S8-6D1 (fhcrc)
Private Clones not available
Severity of mutation (?) Insertion after 6% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI8712
Vector Insertion
Chr 8: 72861532 - 72862104
Public Clones XN217 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 55% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI15099
Vector Insertion
Chr 8: 72859552 - 72861130
Public Clones PST13395-NL (escells) PST4227-NL (escells)
Private Clones not available
Severity of mutation (?) Insertion after 65% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI12708
Vector Insertion
Chr 8: 72857874 - 72857971
Public Clones F012A01 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 83% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000075666
Sequence
GCGACGGCGGTTCCTGTCCAGGGGTCTGAGAGCGGCGGTCGGCTTTGAGGCGAGCAGCGTTACGGAGGGGCGCGGCGGCGGCGGCGGCGGCGGCGGCGGC

GGCGGCGGCGGCGGCAACTCAGAGCTCAGAACCGGCGGCCCGGCTCTGCTTTCGGAGGCCGACTCGGAGCCCGCCCGGCTCTCAGGGCGGCGGCAGCGGC

TACTCCGGATTACGGCCTAGGCCTAGCCGAAGCCTCGGGCTCGAGTGCGGTGAGGCGCCCGCTGAAGGCGCGGCCCGGGCGGCAGGATGAGTGTGGAGGC

GTACGGCCCCAGCTCGCAAACACTCACCTTCTTGGACACTGAGGAGGCCGAGCTGCTCGGCGCCGACACCCAGGGCTCCGAGTTCGAATTCACCGACTTC

ACCCTTCCCAGCCAGACGCAGACGCCCCCCGGCGGCCCCGGCGGCGCGGGAGGCCCGGGCGGAGCGGGCGCAGGCGGCGCGGCCGGCCAGCTCGACGCAC

AA - UNI2625 - GTTGGACCAGAGGGCATCTTGCAAAATGGGGCTGTGGATGACAGTGTGGCCAAGACCAGCCAGCTGCTAGCTGAGCTGAACTTCG

AGGAAGATGAAGAGGACACATACTACACTAAGGACCTCCCAGTCCACGCCTGCAG TTACTGTGGAATCCATGATCCTGCCTGCGTGGTTTACTGTAATA

CCAGCAAGAAGTGGTTCTGCAATGGCCGAGGAAATACTTCTGGCAG CCACATTGTGAATCACCTCGTGAGGGCAAAATGCAAGGAAGTGACGCTGCACA

AGGACGGGCCTCTGGGCGAGACCGTGCTGGAGTGCTACAACTGTGGCTGCCGCAACGTCTTCCTGCTGGGCTTCATCCCTGCGAAGGCCGACTCTGTGGT

GGTGCTGTTGTGCAG GCAGCCCTGTGCCAGCCAGAGCAGCCTGAAGGACATCAACTGGGACAGCTCACAGTGGCAGCCCCTAATCCAGGACCGGTGCTT

TCTGTCATGGCTGGTCAAGATTCCCTCTGAGCAGGAGCAGCTGCGAGCACGGCAGATCACGGCACAGCAGATCAACAAGCTGGAAGAGCTCTGGAAG GA

AAATCCTTCAGCCACTCTGGAGGACCTGGAGAAGCCAGGCGTAGACGAGGAGCCACAGCACGTGCTCCTGCGTTACGAGGATGCTTACCAGTACCAGAAC

ATCTTCGGGCCACTGGTCAAGCTGGAGGCTGACTATGACAAGAAGTTGAAGGAGTCACAG ACTCAAGATAACATCACGGTCAGGTGGGACCTGGGCCTT

AACAAGAAGAGAATCGCCTTCTTCACTTTGCCCAAGACTGACTCTGGTAATGAGGATTTAGTCATAATTTGGTTAAGAG ACATGCGGCTCATGCAGGGT

GATGAGATCTGTCTGCGGTACAAAGGGGATCTGGCGCCCCTGTGGAAGGGGATTGGCCACGTCATCAAGGTTCCTGATA ATTATGGTGATGAGATTGCT

ATTGAGCTCCGCAGCAGCGTGGGTGCCCCTGTGGAAGTGACCCACAACTTCCAAGTGGATTTTGTGTGGAAGTCAACCTCTTTTGATAG GATGCAGAGT

GCACTGAAGACCTTCGCTGTGGACGAGACCTCTGTGTCAGGGTATATTTACCACAAGCTGCTGGGCCACGAGGTGGAGGATGTGGTCATCAAGTGCCAGC

TGCCAAAGCGCTTCACAGCTCAGGGGCTCCCTGACCTCAACCACTCTCAG GTGTATGCTGTGAAGACCGTGCTGCAGAGACCACTCAGCCTCATCCAGG

GCCCTCCAGGCACAGGCAAGACTGTGACATCAGCCACTATTGTCTACCACCTTGCTCGGCAGGGCAATGG GCCTGTACTGGTTTGTGCTCCAAGTAACA

TCGCTGTGGACCAGCTCACAGAGAAGATCCACCAGACAGGACTGAAGGTCGTACGCCTCTGTGCCAAGAGCCGTGAGGCCATTGACTCCCCAGTGTCCTT

CCTGGCTTTGCACAACCAGATCAGGAACATGGACAG CATGCCTGAGCTGCAGAAGCTGCAGCAGCTAAAGGATGAGACAGGCGAGCTGTCATCTGCAGA

TGAGAAGCGGTACCGGGCGCTTAAGCGCACAGCTGAGAGAGAACTTCTCATG - UNI8712 - AATGCAGATGTCATATGCTGCACATGTGTGGGTGC

TGGTGACCCGAGGCTGGCCAAGATGCAGTTCCGTTCCATCCTCATTGACGAGAGCACCCAGGCCACTGAGCCTGAGTGCATGGTGCCTGTAGTCCTTGGG

GCCAAGCAG - UNI15099 - CTAATCCTCGTCGGTGACCACTGCCAGCTGGGCCCAGTGGTGATGTGCAAGAAGGCAGCCAAGGCCGGACTGTCACA

ATCGCTCTTCGAGCGCTTGGTGGTGCTGGGCATCCGGCCCATCCGCCTGCAGGTGCAATACCGCATGCACCCTGCACTCAGCGCCTTTCCGTCCAACATC

TTCTACGAGGGCTCATTGCAGAATGGCGTCACTGCAG - UNI15099 - CGGATCGTGTCAAAAAAGGCTTTGACTTCCAGTGGCCACAACCTGACAA

GCCTATGTTCTTCTACGTGACGCAGGGCCAGGAGGAGATTGCCAGCTCTGGCACATCCTACCTCAACAG - UNI15099 - GACGGAGGCAGCCAATG

TGGAGAAGATAACTACGAAGCTGTTGAAGGCAGGTGCAAAGCCTGACCAGATCGGCATCATCACCCCCTACGAGGGCCAGCGCTCTTACTTGGTGCAGTA

CATGCAGTTCAGCGGCTCCCTGCACACAAAGCTCTACCAG GAAGTGGAAATTGCCAGTGTGGACGCCTTCCAGGGCCGGGAGAAGGACTTCATCATTCT

GTCCTGCGTGCGCGCCAATGAACATCAGGGCATTGGGTTCCTAAACGACCCCCGGCGTCTGAATGTGGCTCTCACCAGAGCAAG ATATGGCGTGATCAT

TGTGGGTAACCCAAAGGCCCTGTCGAAGCAGCCCCTGTGGAATCACCTGCTGAGCTACTACAAGGAACAGAAGGCGCTAGTGGAAGGGCCGCTCAACAAC

CTACGTGAGAGCCTCATGCAGTTCAGCAAGCCTCGCAAACTTGTCAACACTGTCAACCCG - UNI12708 - GGTGCCCGCTTCATGACTACTGCCAT

GTACGATGCCCGTGAGGCCATCATCCCCGGGTCTGTCTATGACCGCAGCAGCCAGG GCCGGCCCTCGAACATGTACTTCCAGACCCATGACCAGATTAG

TATGATCAGCGCAGGCCCCAGCCACGTGGCTGCCATGAACATCCCTATTCCCTTCAACTTGGTCATGCCTCCCATGCCGCCACCTGGCTACTTCGGACAG

GCCAACGGGCCGGCAGCTG GTCGGGGCACCCCAAAAACCAAGACTGGCCGTGGGGGCCGCCAGAAGAACCGCTTTGGGCTTCCTGGGCCCAGCCAGACC

ACCCTTCCCAACAGCCAGGCCAGCCAGGACGTGGCCTCCCAGCCCTTTTCACAGGGTGCCCTCACACAGGGTTACGTGTCCATGAGCCAGCCCTCTCAGA

TGAGCCAGCCTGGCCTCTCCCAGCCAGAACTGTCCCAG GACAGCTACCTCGGTGATGAGTTTAAATCACAGATTGACGTGGCACTCTCACAAGACTCCA

CATACCAGGGAGAGCGGGCATACCAGCACGGCGGGGTCACCGGGCTGTCCCAGTACTAGAAG GTAGCGGAGGAAGAGCTAAGCTATGTGGCTTAGTCTA

TCAGCATCTTATTCTGGGTAATAAAAAATAAAAATAAATGGATACCTGTTTTCCACTGCTAAAACTGAAGCACCACTGTGTGAGCAGCCGAGGAGAGGAG

AGGAAAGAGGAGCGAGAGCGAGCAGAGAGCGGCCAGGGAGGACGACAGAGCGGAGCGCCGAGGAGCGGGCGCCCCCTGTGGGCGGCGAGAGGAGAGAGGC

CCGCACCGCTGCGAGGCCGGCCCAGCGCCGTGCCCGCCAGAGGGAGAGGCCTCGCCAGGACCGGCCCCGCTGTTCTTTTTCTTTGTTTCTCGTGATTGAG

GGGCTACGTTTTAGCAGGACGAACTTCGCGTTTCTGTGCCCAAGCGGGCGGCCAGGAGCATCAGTGCGCGGTCCCAGCGCTAAGGGGTTTCATTTAAAGA

AAATACGGTGTTTGGGGTTTTTCTGGTTTTTCTTTTTTTTTTCTTTTTTTTGGTTTTTTTTTTTTGTTTGTTTGTTTGGTTTTTTTTTTTTTTCTTTTTG

GTTTTCCTTTCCTCCCCCCTACCCCCTTCAAAGATTCTTTCAAAGGAGTATGGGAAGTACTTGGATCGGTTTGTCTCTAGAGACCTGACTGTTAAACCTG

AGAGATGCGAGAAGCTTCCGGGAAAGGCAGCGCTGAGAAGCCTGAGCCCCGCAGCCTGGGATCACCGCCTGCACCGCAGCCGGAGGATTTGTTTTTGAGT

TTGAGCTTCAGAGGCCACAGGCGAACTCGTGAGCACGGCCTGCGGGTTCTTCCCCATCGAGGGTGGAGGCCTCATTGCTGGGCGCCCTGCCCCGGACCCC

CACCTCCCGCGGCAGCCACCCAACCCCTACCCAGGCACACCTGCGCCAACGCAATGGAACTTAATTTTTAGTCAAATTTGTTTTAAGCTTTTTGTCACCA

ATAAAACATG
Translation
MSVEAYGPSSQTLTFLDTEEAELLGADTQGSEFEFTDFTLPSQTQTPPGGPGGAGGPGGAGAGGAAGQLDAQ - UNI2625 - VGPEGILQNGAVDDS

VAKTSQLLAELNFEEDEEDTYYTKDLPVHACS SYCGIHDPACVVYCNTSKKWFCNGRGNTSGS SHIVNHLVRAKCKEVTLHKDGPLGETVLECYNCGC

RNVFLLGFIPAKADSVVVLLCR RQPCASQSSLKDINWDSSQWQPLIQDRCFLSWLVKIPSEQEQLRARQITAQQINKLEELWK ENPSATLEDLEKPGV

DEEPQHVLLRYEDAYQYQNIFGPLVKLEADYDKKLKESQ TQDNITVRWDLGLNKKRIAFFTLPKTDSGNEDLVIIWLRD DMRLMQGDEICLRYKGDLA

PLWKGIGHVIKVPDN NYGDEIAIELRSSVGAPVEVTHNFQVDFVWKSTSFDR RMQSALKTFAVDETSVSGYIYHKLLGHEVEDVVIKCQLPKRFTAQG

LPDLNHSQ VYAVKTVLQRPLSLIQGPPGTGKTVTSATIVYHLARQGNG GPVLVCAPSNIAVDQLTEKIHQTGLKVVRLCAKSREAIDSPVSFLALHNQ

IRNMDS SMPELQKLQQLKDETGELSSADEKRYRALKRTAERELLM - UNI8712 - NADVICCTCVGAGDPRLAKMQFRSILIDESTQATEPECMVP

VVLGAKQ - UNI15099 - LILVGDHCQLGPVVMCKKAAKAGLSQSLFERLVVLGIRPIRLQVQYRMHPALSAFPSNIFYEGSLQNGVTAA - UNI1

5099 - ADRVKKGFDFQWPQPDKPMFFYVTQGQEEIASSGTSYLNR - UNI15099 - RTEAANVEKITTKLLKAGAKPDQIGIITPYEGQRSYLVQ

YMQFSGSLHTKLYQ EVEIASVDAFQGREKDFIILSCVRANEHQGIGFLNDPRRLNVALTRAR RYGVIIVGNPKALSKQPLWNHLLSYYKEQKALVEGP

LNNLRESLMQFSKPRKLVNTVNP - UNI12708 - GARFMTTAMYDAREAIIPGSVYDRSSQG GRPSNMYFQTHDQISMISAGPSHVAAMNIPIPFN

LVMPPMPPPGYFGQANGPAAG GRGTPKTKTGRGGRQKNRFGLPGPSQTTLPNSQASQDVASQPFSQGALTQGYVSMSQPSQMSQPGLSQPELSQ DSYL

GDEFKSQIDVALSQDSTYQGERAYQHGGVTGLSQY 

For any suggestions or comments, please send an email to unitrap@crg.es