Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000058318 (Phf21a)
Chromosomal location
Chr 2: 91933274 - 92204822 (+)
Description
PHD finger protein 21A Gene [Source:MGI (curated);Acc:Phf21a-002]
RefSeq_dna
NM_138755 
RefSeq_peptide
NP_001103160.1 NP_620094.2 NP_001103161.1 
MGI
MGI:2384756 
Uniprot/SPTREMBL
A2AHG2 A2AHG4 A2AHG3 A2AHG1 Q6XVF9 
Human Ortholog
ENSG00000135365 (PHF21A)
Omim not available
UniTrap UNI31455
Vector Insertion
Chr 2: 91933311 - 92024262
Public Clones IST14756G5 (tigm) IST14161H7 (tigm) IST13871G8 (tigm) IST13963D7 (tigm)
IST13702D4 (tigm) IST14707G10 (tigm) IST13639G6 (tigm) IST14682G11 (tigm)
IST14290A12 (tigm) IST12356H10 (tigm) IST10099E2 (tigm) IST10947A6 (tigm)
IST12124H4 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI34655
Vector Insertion
Chr 2: 92024510 - 92025639
Public Clones IST12852G4 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI14434
Vector Insertion
Chr 2: 92026767 - 92054205
Public Clones (sanger) 5SD057H01 (ggtc) 3SD057H01 (ggtc) FHCRC-GT-S13-12F1 (fhcrc) IST12174H7BBR1 (tigm)
IST14833C7 (tigm) IST14391A9 (tigm) IST10131H6 (tigm) IST12174H7 (tigm)
IST14672E2 (tigm) IST14582C4 (tigm) IST14279B7 (tigm) IST14833D3 (tigm)
IST14960F7 (tigm) IST13215F4 (tigm) IST14411A1 (tigm) IST14951G3 (tigm)
IST12726H2 (tigm) IST13215B9 (tigm) IST13224H12 (tigm) IST14451G4 (tigm)
IST12061C11 (tigm) IST13213F11 (tigm) IST13529C10 (tigm) IST11134A6 (tigm)
IST13215C5 (tigm) IST14875B11 (tigm) IST14672C5 (tigm) IST13102A11 (tigm)
IST14883F11 (tigm) IST13241A3 (tigm) IST14596F2 (tigm) IST12849A7 (tigm)
IST14960C7 (tigm) IST12159A5 (tigm) IST12155C6 (tigm) IST10026D12 (tigm)
IST12818B9 (tigm) IST12850C5 (tigm) IST13234G8 (tigm) IST13256B3 (tigm)
IST13200G6 (tigm) IST12164A2 (tigm) IST13547G6 (tigm) IST13213C8 (tigm)
IST13217C1 (tigm) IST12159H5 (tigm) IST14951B2 (tigm) IST13545D6 (tigm)
IST13253A11 (tigm) IST13105D7 (tigm) IST11528G7 (tigm) IST13612H2 (tigm)
IST13220A12 (tigm)
Private Clones OST430246 (lexicon) OST341405 (lexicon) OST220228 (lexicon) OST35349 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI20077
Vector Insertion
Chr 2: 92054247 - 92055620
Public Clones not available
Private Clones OST373671 (lexicon) OST33404 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI3188
Vector Insertion
Chr 2: 92061626 - 92061773
Public Clones AB0058 (sanger) XR0684 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI16699
Vector Insertion
Chr 2: 92061626 - 92061773
Public Clones not available
Private Clones OST455779 (lexicon) OST296414 (lexicon) OST282900 (lexicon) OST250923 (lexicon)
OST77704 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI22192
Vector Insertion
Chr 2: 92068605 - 92068639
Public Clones not available
Private Clones OST303715 (lexicon) OST278834 (lexicon) OST238267 (lexicon) OST213327 (lexicon)
OST211809 (lexicon) OST73332 (lexicon)
Severity of mutation (?) Insertion after 3% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI23759
Vector Insertion
Chr 2: 92068639 - 92070815
Public Clones not available
Private Clones OST245763 (lexicon) OST144518 (lexicon) OST134167 (lexicon)
Severity of mutation (?) Insertion after 4% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI37568
Vector Insertion
Chr 2: 92070815 - 92070882
Public Clones (egtc)
Private Clones not available
Severity of mutation (?) Insertion after 4% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI7400
Vector Insertion
Chr 2: 92070882 - 92160385
Public Clones RRR600 (baygenomics) RRR754 (baygenomics) RRS576 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 7% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI26419
Vector Insertion
Chr 2: 92160385 - 92160617
Public Clones not available
Private Clones OST119132 (lexicon)
Severity of mutation (?) Insertion after 7% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI20910
Vector Insertion
Chr 2: 92197177 - 92198850
Public Clones not available
Private Clones OST348484 (lexicon)
Severity of mutation (?) Insertion after 79% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000090586
Sequence
TGAGAACAACAACAAAAACTGAGCCCACTACCTCATA - UNI3188 - - UNI14434 - - UNI16699 - - UNI20077 - - UNI31455 

- - UNI34655 - AGCTGCAGCAACAAGAGGAGCTTGTAATTTTAAACGGAGGCTGAAGACACTGTAGAATTAGCAGACATAAGAGAGCGTGGAGAAG

GCAGAGGATGGAGTTGCAGACTCTACAGGAGGCTCTTAAAGTGGAAATTCAGGTTCACCAG - UNI3188 - - UNI16699 - - UNI22192 - 

AAACTGGTTGCCCAAATGAAGCAGGATCCACAG - UNI22192 - - UNI23759 - AATGCTGACTTAAAGAAACAGCTTCATGAACTCCAAGCCA

AAATCACAGCTTTGAGTGAGAAACAG - UNI7400 - - UNI26419 - AAAAGAGTAGTTGAGCAGCTGCGCAAGAACCTGATAGTCAAACAAGAG

CAGCCGGACAAGTTCCAGATACAGCCATTGTCACAGTCTGAAAACAAACTACAAACAGCACAGCAGCAGCCACTACAGCCACTGCAGCAGCAGCAACCGC

AGCAACCGCAGCAGCAGCAGCAGCAGCAGCAGCAGCACGCCCAGCAGTCAGCAGCAGCACCGCCTAGTCTAACTGCATCACAG - UNI26419 - AAG

ACTGTAACTACAGCTTCTATGATTACCACAAAGACACTACCTCTCGTCTTGAAAGCAGCAACTGCGACCATGCCTGCCTCTGTTGTGGGCCAGAGACCTA

CCATTGCTATGGTGACCGCCATCAACAGCCAGAAGGCTGTGCTCAGCACTGATGTGCAGAACACACCAGTCAACCTCCAGACGTCTAGTAAGGTCACTGG

GCCTGGGGCAGAGGCTGTCCAAATTGTGGCAAAAAACACAGTCACTCTG CAGGTTCAAGCAACACCTCCTCAGCCCATCAAAGTACCACAGTTTATCCC

TCCTCCTAGACTCACTCCACGCCCAAACTTCCTTCCACAG GTTCGACCCAAGCCTGTGGCCCAGAATAACATTCCTATCGCTCCAGCGCCTCCTCCCAT

GCTTGCAGCTCCTCAGCTTATCCAGAGGCCTGTCATGCTGACCAAGTTTACACCCACAACCCTCCCCACATCCCAGAATTCCATCCACCCTGTCCGTGTT

GTCAATGGACAGACTGCAACCATAGCCAAAACGTTCCCCATGGCCCAGCTCACCAGCATTGTCATAGCTACTCCAGGGACCAGACTCCCTGGACCTCAGA

CTGTACAGCTTAGCAAACCAAGCCTGGAGAAACAG ACAGTTAAATCCCACCCAGAAGCAGAGGAAAAACAAGCAGAGAGCCGTACCGTTACCCCACCTG

CTGCACCAAAACCAAAACGAGAAGAGAACCCTCAG AAACTTGCCTTCATGGTGTCTCTAGGGTTGGTAACACATGACCATCTAGAAG AAATCCAAAGC

AAGAGGCAGGAAAGAAAGAGAAGAACAACAGCAAACCCGGTGTACAGTGGGGCTGTCTTTGAGCCAGAG CGTAAGAAGAGTGCAGTCACTTACCTTAAC

AGCACAATGCATCCTGGGACGCGGAAGAGAG GTCGTCCTCCAAAATACAATGCGGTGCTGGGGTTTGGAGCCCTTACCCCAACATCCCCCCCATCCAGT

CATCCCGACTCCCCTGAAAATGAAAAGACAGAGACCACATTCACTTTCCCTGCACCTGTTCAGCCTGTGTCTTTGCCCAGCCCCACCTCCACAGAC GGT

GATATCCATGAGGATTTTTGCAGTGTTTGCAGAAAAAGTGGCCAGTTGCTGATGTGTGACACGTGTTCCCGTGTGTATCATCTGGACTGCTTAGAGCCGC

CCCTGAAAACAATTCCCAAGGGCATGTGGATCTGTCCCAGATGTCAGGACCAG - UNI20910 - ATGCTAAAGAAGGAAGAAGCAATTCCTTGGCCT

GGAACCTTAGCCATTGTTCATTCCTACATCGCCTACAAAGCAG CAAAAGAAGAGGAGAAACAGAAGCTACTTAAGTGGAGTTCAGATTTAAAACAGGAG

CGGGAACAACTGGAGCAGAAGGTCAAAGAGCTCAGCAGTTCTATAAGT AAATGTATGGAGATGAAGAGCAGCATCCTGGCGCGGCAGAAGGAGATGCGC

AGCTCCCTGGACAAGGTGAAGCGGCTCATCCGCCTTGTGCATGGCGTCGACCTCTGCAGACCTGTGGACTCAGAGGCCACGGCGGGGGCCCTCTCCAATG

GCCCAGACTGCACTCCCCCTGCCAACGCCGCCTCCACACCCGCCCCTTCCCCCTCCTCGCAGAGCTGCACAGCGAACTGTAACCAGGGGGAAGAGACTAA

ATAACAGAGCCCTCGAGGCGGACATGCCACAGTCCTGGTGGCGAGGAGACGCTAGAAGAGCAAAGCCGGATTTCTTCTGGAAAGTACAGAGTTCTTTTGG

TTCTTTGGTTCCAGAGAGAGAGAAGATGCTTGTGCCAGGTGGCACCCGAGTTTGCCAATTGATTCTTGTTATTCTGTGTGTACATGCAAAGACTGGACCA

TGTTACATGAAATAGTGCCAGCTGGAGGTTCTTTGCCAGCACCATGCCAAGTGACATAATATATTACTCTCTCTATTATACACCAGTGTGTGCCTGCAGC

AGCCTCCACAGCCACGGTGGGTTCGTTTTTGTTTTGTTGGGTGGGGAGCAGGGACGGGCGGAGGGAGGAGAGCAGGTTTCAGATCCTTACTGGGAGCCGT

TTGTTTAGGTAGAAAGACAAGTCCAAAGAGTGTGTGGGCTTTCCTGTTCCTAAACTTTTCACTACCATAAAACC
Translation
 - UNI3188 - - UNI14434 - - UNI16699 - - UNI20077 - - UNI31455 - - UNI34655 - MELQTLQEALKVEIQVHQ - U

NI3188 - - UNI16699 - - UNI22192 - KLVAQMKQDPQ - UNI22192 - - UNI23759 - NADLKKQLHELQAKITALSEKQ - UN

I7400 - - UNI26419 - KRVVEQLRKNLIVKQEQPDKFQIQPLSQSENKLQTAQQQPLQPLQQQQPQQPQQQQQQQQQHAQQSAAAPPSLTASQ -

 UNI26419 - KTVTTASMITTKTLPLVLKAATATMPASVVGQRPTIAMVTAINSQKAVLSTDVQNTPVNLQTSSKVTGPGAEAVQIVAKNTVTL QVQ

ATPPQPIKVPQFIPPPRLTPRPNFLPQ VRPKPVAQNNIPIAPAPPPMLAAPQLIQRPVMLTKFTPTTLPTSQNSIHPVRVVNGQTATIAKTFPMAQLTS

IVIATPGTRLPGPQTVQLSKPSLEKQ TVKSHPEAEEKQAESRTVTPPAAPKPKREENPQ KLAFMVSLGLVTHDHLEE EIQSKRQERKRRTTANPVYS

GAVFEPE RKKSAVTYLNSTMHPGTRKRG GRPPKYNAVLGFGALTPTSPPSSHPDSPENEKTETTFTFPAPVQPVSLPSPTSTD GDIHEDFCSVCRKS

GQLLMCDTCSRVYHLDCLEPPLKTIPKGMWICPRCQDQ - UNI20910 - MLKKEEAIPWPGTLAIVHSYIAYKAA AKEEEKQKLLKWSSDLKQERE

QLEQKVKELSSSIS KCMEMKSSILARQKEMRSSLDKVKRLIRLVHGVDLCRPVDSEATAGALSNGPDCTPPANAASTPAPSPSSQSCTANCNQGEETK
Transcript ENSMUST00000111297
Sequence
TGAGAACAACAACAAAAACTGAGCCCACTACCTCATA - UNI3188 - - UNI14434 - - UNI16699 - - UNI20077 - - UNI31455 

- - UNI34655 - AGCTGCAGCAACAAGAGGAGCTTGTAATTTTAAACGGAGGCTGAAGACACTGTAGAATTAGCAGACATAAGAGAGCGTGGAGAAG

GCAGAGGATGGAGTTGCAGACTCTACAGGAGGCTCTTAAAGTGGAAATTCAGGTTCACCAG - UNI3188 - - UNI16699 - - UNI22192 - 

AAACTGGTTGCCCAAATGAAGCAGGATCCACAG - UNI22192 - - UNI23759 - AATGCTGACTTAAAGAAACAGCTTCATGAACTCCAAGCCA

AAATCACAGCTTTGAGTGAGAAACAG - UNI7400 - - UNI26419 - AAAAGAGTAGTTGAGCAGCTGCGCAAGAACCTGATAGTCAAACAAGAG

CAGCCGGACAAGTTCCAGATACAGCCATTGTCACAGTCTGAAAACAAACTACAAACAGCACAGCAGCAGCCACTACAGCCACTGCAGCAGCAGCAACCGC

AGCAACCGCAGCAGCAGCAGCAGCAGCAGCAGCAGCACGCCCAGCAGTCAGCAGCAGCACCGCCTAGTCTAACTGCATCACAG - UNI26419 - AAG

ACTGTAACTACAGCTTCTATGATTACCACAAAGACACTACCTCTCGTCTTGAAAGCAGCAACTGCGACCATGCCTGCCTCTGTTGTGGGCCAGAGACCTA

CCATTGCTATGGTGACCGCCATCAACAGCCAGAAGGCTGTGCTCAGCACTGATGTGCAGAACACACCAGTCAACCTCCAGACGTCTAGTAAGGTCACTGG

GCCTGGGGCAGAGGCTGTCCAAATTGTGGCAAAAAACACAGTCACTCTG CAGGTTCAAGCAACACCTCCTCAGCCCATCAAAGTACCACAGTTTATCCC

TCCTCCTAGACTCACTCCACGCCCAAACTTCCTTCCACAG GTTCGACCCAAGCCTGTGGCCCAGAATAACATTCCTATCGCTCCAGCGCCTCCTCCCAT

GCTTGCAGCTCCTCAGCTTATCCAGAGGCCTGTCATGCTGACCAAGTTTACACCCACAACCCTCCCCACATCCCAGAATTCCATCCACCCTGTCCGTGTT

GTCAATGGACAGACTGCAACCATAGCCAAAACGTTCCCCATGGCCCAGCTCACCAGCATTGTCATAGCTACTCCAGGGACCAGACTCCCTGGACCTCAGA

CTGTACAGCTTAGCAAACCAAGCCTGGAGAAACAG ACAGTTAAATCCCACCCAGAAGCAGAGGAAAAACAAGCAGAGAGCCGTACCGTTACCCCACCTG

CTGCACCAAAACCAAAACGAGAAGAGAACCCTCAG AAACTTGCCTTCATGGTGTCTCTAGGGTTGGTAACACATGACCATCTAGAAG AAATCCAAAGC

AAGAGGCAGGAAAGAAAGAGAAGAACAACAGCAAACCCGGTGTACAGTGGGGCTGTCTTTGAGCCAGAG CGTAAGAAGAGTGCAGTCACTTACCTTAAC

AGCACAATGCATCCTGGGACGCGGAAGAGAG CCAATGAGGAACACTGGCCAAAG GGTGATATCCATGAGGATTTTTGCAGTGTTTGCAGAAAAAGTGG

CCAGTTGCTGATGTGTGACACGTGTTCCCGTGTGTATCATCTGGACTGCTTAGAGCCGCCCCTGAAAACAATTCCCAAGGGCATGTGGATCTGTCCCAGA

TGTCAGGACCAG - UNI20910 - ATGCTAAAGAAGGAAGAAGCAATTCCTTGGCCTGGAACCTTAGCCATTGTTCATTCCTACATCGCCTACAAAGC

AG CAAAAGAAGAGGAGAAACAGAAGCTACTTAAGTGGAGTTCAGATTTAAAACAGGAGCGGGAACAACTGGAGCAGAAGGTCAAAGAGCTCAGCAGTTC

TATAAGT AAATGTATGGAGATGAAGAGCAGCATCCTGGCGCGGCAGAAGGAGATGCGCAGCTCCCTGGACAAGGTGAAGCGGCTCATCCGCCTTGTGCA

TGGCGTCGACCTCTGCAGACCTGTGGACTCAGAGGCCACGGCGGGGGCCCTCTCCAATGGCCCAGACTGCACTCCCCCTGCCAACGCCGCCTCCACACCC

GCCCCTTCCCCCTCCTCGCAGAGCTGCACAGCGAACTGTAACCAGGGGGAAGAGACTAAATAACAGAGCCCTCGAGGCGGACATGCCACAGTCCTGGTGG

CGAGGAGACGCTAGAAGAGCAAAGCCGGATTTCTTCTGGAAAGTACAGAGTTCTTTTGGTTCTTTGGTTCCAGAGAGAGAGAAGATGCTTGTGCCAGGTG

GCACCCGAGTTTGCCAATTGATTCTTGTTATTCTGTGTGTACATGCAAAGACTGGACCATGTTACATGAAATAGTGCCAGCTGGAGGTTCTTTGCCAGCA

CCATGCCAAGTGACATAATATATTACTCTCTCTATTATACACCAGTGTGTGCCTGCAGCAGCCTCCACAGCCACGGTGGGTTCGTTTTTGTTTTGTTGGG

TGGGGAGCAGGGACGGGCGGAGGGAGGAGAGCAGGTTTCAGATCCTTACTGGGAGCCGTTTGTTTAGGTAGAAAGACAAGTCCAAAGAGTGTGTGGGCTT

TCCTGTTCCTAAACTTTTCACTACCATAAAACC
Translation
 - UNI3188 - - UNI14434 - - UNI16699 - - UNI20077 - - UNI31455 - - UNI34655 - MELQTLQEALKVEIQVHQ - U

NI3188 - - UNI16699 - - UNI22192 - KLVAQMKQDPQ - UNI22192 - - UNI23759 - NADLKKQLHELQAKITALSEKQ - UN

I7400 - - UNI26419 - KRVVEQLRKNLIVKQEQPDKFQIQPLSQSENKLQTAQQQPLQPLQQQQPQQPQQQQQQQQQHAQQSAAAPPSLTASQ -

 UNI26419 - KTVTTASMITTKTLPLVLKAATATMPASVVGQRPTIAMVTAINSQKAVLSTDVQNTPVNLQTSSKVTGPGAEAVQIVAKNTVTL QVQ

ATPPQPIKVPQFIPPPRLTPRPNFLPQ VRPKPVAQNNIPIAPAPPPMLAAPQLIQRPVMLTKFTPTTLPTSQNSIHPVRVVNGQTATIAKTFPMAQLTS

IVIATPGTRLPGPQTVQLSKPSLEKQ TVKSHPEAEEKQAESRTVTPPAAPKPKREENPQ KLAFMVSLGLVTHDHLEE EIQSKRQERKRRTTANPVYS

GAVFEPE RKKSAVTYLNSTMHPGTRKRA ANEEHWPK GDIHEDFCSVCRKSGQLLMCDTCSRVYHLDCLEPPLKTIPKGMWICPRCQDQ - UNI209

10 - MLKKEEAIPWPGTLAIVHSYIAYKAA AKEEEKQKLLKWSSDLKQEREQLEQKVKELSSSIS KCMEMKSSILARQKEMRSSLDKVKRLIRLVHG

VDLCRPVDSEATAGALSNGPDCTPPANAASTPAPSPSSQSCTANCNQGEETK
Transcript ENSMUST00000068702
Sequence
TGAGAACAACAACAAAAACTGAGCCCACTACCTCATA - UNI3188 - - UNI14434 - - UNI16699 - - UNI20077 - - UNI31455 

- - UNI34655 - AGCTGCAGCAACAAGAGGAGCTTGTAATTTTAAACGGAGGCTGAAGACACTGTAGAATTAGCAGACATAAGAGAGCGTGGAGAAG

GCAGAGGATGGAGTTGCAGACTCTACAGGAGGCTCTTAAAGTGGAAATTCAGGTTCACCAG - UNI3188 - - UNI16699 - - UNI22192 - 

AAACTGGTTGCCCAAATGAAGCAGGATCCACAG - UNI22192 - - UNI23759 - AATGCTGACTTAAAGAAACAGCTTCATGAACTCCAAGCCA

AAATCACAGCTTTGAGTGAGAAACAG - UNI7400 - - UNI26419 - AAAAGAGTAGTTGAGCAGCTGCGCAAGAACCTGATAGTCAAACAAGAG

CAGCCGGACAAGTTCCAGATACAGCCATTGTCACAGTCTGAAAACAAACTACAAACAGCACAGCAGCAGCCACTACAGCCACTGCAGCAGCAGCAACCGC

AGCAACCGCAGCAGCAGCAGCAGCAGCAGCAGCAGCACGCCCAGCAGTCAGCAGCAGCACCGCCTAGTCTAACTGCATCACAG - UNI26419 - GTT

CAAGCAACACCTCCTCAGCCCATCAAAGTACCACAGTTTATCCCTCCTCCTAGACTCACTCCACGCCCAAACTTCCTTCCACAG GTTCGACCCAAGCCT

GTGGCCCAGAATAACATTCCTATCGCTCCAGCGCCTCCTCCCATGCTTGCAGCTCCTCAGCTTATCCAGAGGCCTGTCATGCTGACCAAGTTTACACCCA

CAACCCTCCCCACATCCCAGAATTCCATCCACCCTGTCCGTGTTGTCAATGGACAGACTGCAACCATAGCCAAAACGTTCCCCATGGCCCAGCTCACCAG

CATTGTCATAGCTACTCCAGGGACCAGACTCCCTGGACCTCAGACTGTACAGCTTAGCAAACCAAGCCTGGAGAAACAG ACAGTTAAATCCCACCCAGA

AGCAGAGGAAAAACAAGCAGAGAGCCGTACCGTTACCCCACCTGCTGCACCAAAACCAAAACGAGAAGAGAACCCTCAG AAACTTGCCTTCATGGTGTC

TCTAGGGTTGGTAACACATGACCATCTAGAAG AAATCCAAAGCAAGAGGCAGGAAAGAAAGAGAAGAACAACAGCAAACCCGGTGTACAGTGGGGCTGT

CTTTGAGCCAGAG CGTAAGAAGAGTGCAGTCACTTACCTTAACAGCACAATGCATCCTGGGACGCGGAAGAGAG CCAATGAGGAACACTGGCCAAAG 

GGTGATATCCATGAGGATTTTTGCAGTGTTTGCAGAAAAAGTGGCCAGTTGCTGATGTGTGACACGTGTTCCCGTGTGTATCATCTGGACTGCTTAGAGC

CGCCCCTGAAAACAATTCCCAAGGGCATGTGGATCTGTCCCAGATGTCAGGACCAG - UNI20910 - ATGCTAAAGAAGGAAGAAGCAATTCCTTGG

CCTGGAACCTTAGCCATTGTTCATTCCTACATCGCCTACAAAGCAG CAAAAGAAGAGGAGAAACAGAAGCTACTTAAGTGGAGTTCAGATTTAAAACAG

GAGCGGGAACAACTGGAGCAGAAGGTCAAAGAGCTCAGCAGTTCTATAAGT AAATGTATGGAGATGAAGAGCAGCATCCTGGCGCGGCAGAAGGAGATG

CGCAGCTCCCTGGACAAGGTGAAGCGGCTCATCCGCCTTGTGCATGGCGTCGACCTCTGCAGACCTGTGGACTCAGAGGCCACGGCGGGGGCCCTCTCCA

ATGGCCCAGACTGCACTCCCCCTGCCAACGCCGCCTCCACACCCGCCCCTTCCCCCTCCTCGCAGAGCTGCACAGCGAACTGTAACCAGGGGGAAGAGAC

TAAATAACAGAGCCCTCGAGGCGGACATGCCACAGTCCTGGTGGCGAGGAGACGCTAGAAGAGCAAAGCCGGATTTCTTCTGGAAAGTACAGAGTTCTTT

TGGTTCTTTGGTTCCAGAGAGAGAGAAGATGCTTGTGCCAGGTGGCACCCGAGTTTGCCAATTGATTCTTGTTATTCTGTGTGTACATGCAAAGACTGGA

CCATGTTACATGAAATAGTGCCAGCTGGAGGTTCTTTGCCAGCACCATGCCAAGTGACATAATATATTACTCTCTCTATTATACACCAGTGTGTGCCTGC

AGCAGCCTCCACAGCCACGGTGGGTTCGTTTTTGTTTTGTTGGGTGGGGAGCAGGGACGGGCGGAGGGAGGAGAGCAGGTTTCAGATCCTTACTGGGAGC

CGTTTGTTTAGGTAGAAAGACAAGTCCAAAGAGTGTGTGGGCTTTCCTGTTCCTAAACTTTTCACTACCATAAAACC
Translation
 - UNI3188 - - UNI14434 - - UNI16699 - - UNI20077 - - UNI31455 - - UNI34655 - MELQTLQEALKVEIQVHQ - U

NI3188 - - UNI16699 - - UNI22192 - KLVAQMKQDPQ - UNI22192 - - UNI23759 - NADLKKQLHELQAKITALSEKQ - UN

I7400 - - UNI26419 - KRVVEQLRKNLIVKQEQPDKFQIQPLSQSENKLQTAQQQPLQPLQQQQPQQPQQQQQQQQQHAQQSAAAPPSLTASQ -

 UNI26419 - VQATPPQPIKVPQFIPPPRLTPRPNFLPQ VRPKPVAQNNIPIAPAPPPMLAAPQLIQRPVMLTKFTPTTLPTSQNSIHPVRVVNGQT

ATIAKTFPMAQLTSIVIATPGTRLPGPQTVQLSKPSLEKQ TVKSHPEAEEKQAESRTVTPPAAPKPKREENPQ KLAFMVSLGLVTHDHLEE EIQSKR

QERKRRTTANPVYSGAVFEPE RKKSAVTYLNSTMHPGTRKRA ANEEHWPK GDIHEDFCSVCRKSGQLLMCDTCSRVYHLDCLEPPLKTIPKGMWICP

RCQDQ - UNI20910 - MLKKEEAIPWPGTLAIVHSYIAYKAA AKEEEKQKLLKWSSDLKQEREQLEQKVKELSSSIS KCMEMKSSILARQKEMRS

SLDKVKRLIRLVHGVDLCRPVDSEATAGALSNGPDCTPPANAASTPAPSPSSQSCTANCNQGEETK
Transcript ENSMUST00000111294
Sequence
GTGTGAGTGAGTGAGAGAGAGGAGAGGAGGAGGAGGAGGGAGAAGGGAACAACCTACCATCTTAACACACTAATATCTAAAAAGTGCGAGAGGCCCAGAG

CAGCAGCAGCAGAAGCAGCAGCGGCAGCTCCAGCCTCTTCCCTCCCTCCCCATGAAGAAGAGTTCCCTCCTCCTCCTCCTCCTGCTTCTCCTGCTCAGAG

TTCCTGCCTCCAGCTGCCAGGGGGGACAGCCAGCCAGCAGCAGGAGG - UNI14434 - - UNI34655 - GGGACTGGAGAGCTGAAGGAGCGCCA

GCTTCTCCAGAATTG - UNI3188 - - UNI16699 - - UNI20077 - CTGCAGCAACAAGAGGAGCTTGTAATTTTAAACGGAGGCTGAAGAC

ACTGTAGAATTAGCAGACATAAGAGAGCGTGGAGAAGGCAGAGGATGGAGTTGCAGACTCTACAGGAGGCTCTTAAAGTGGAAATTCAGGTTCACCAG -

 UNI3188 - - UNI16699 - - UNI22192 - AAACTGGTTGCCCAAATGAAGCAGGATCCACAG - UNI22192 - - UNI23759 - AAT

GCTGACTTAAAGAAACAGCTTCATGAACTCCAAGCCAAAATCACAGCTTTGAGTGAGAAACAG - UNI7400 - - UNI26419 - AAAAGAGTAGT

TGAGCAGCTGCGCAAGAACCTGATAGTCAAACAAGAGCAGCCGGACAAGTTCCAGATACAGCCATTGTCACAGTCTGAAAACAAACTACAAACAGCACAG

CAGCAGCCACTACAGCCACTGCAGCAGCAGCAACCGCAGCAACCGCAGCAGCAGCAGCAGCAGCAGCAGCAGCACGCCCAGCAGTCAGCAGCAGCACCGC

CTAGTCTAACTGCATCACAG - UNI26419 - AAGACTGTAACTACAGCTTCTATGATTACCACAAAGACACTACCTCTCGTCTTGAAAGCAGCAACT

GCGACCATGCCTGCCTCTGTTGTGGGCCAGAGACCTACCATTGCTATGGTGACCGCCATCAACAGCCAGAAGGCTGTGCTCAGCACTGATGTGCAGAACA

CACCAGTCAACCTCCAGACGTCTAGTAAGGTCACTGGGCCTGGGGCAGAGGCTGTCCAAATTGTGGCAAAAAACACAGTCACTCTG CAGGTTCAAGCAA

CACCTCCTCAGCCCATCAAAGTACCACAGTTTATCCCTCCTCCTAGACTCACTCCACGCCCAAACTTCCTTCCACAG GTTCGACCCAAGCCTGTGGCCC

AGAATAACATTCCTATCGCTCCAGCGCCTCCTCCCATGCTTGCAGCTCCTCAGCTTATCCAGAGGCCTGTCATGCTGACCAAGTTTACACCCACAACCCT

CCCCACATCCCAGAATTCCATCCACCCTGTCCGTGTTGTCAATGGACAGACTGCAACCATAGCCAAAACGTTCCCCATGGCCCAGCTCACCAGCATTGTC

ATAGCTACTCCAGGGACCAGACTCCCTGGACCTCAGACTGTACAGCTTAGCAAACCAAGCCTGGAGAAACAG ACAGTTAAATCCCACCCAGAAGCAGAG

GAAAAACAAGCAGAGAGCCGTACCGTTACCCCACCTGCTGCACCAAAACCAAAACGAGAAGAGAACCCTCAG AAACTTGCCTTCATGGTGTCTCTAGGG

TTGGTAACACATGACCATCTAGAAG AAATCCAAAGCAAGAGGCAGGAAAGAAAGAGAAGAACAACAGCAAACCCGGTGTACAGTGGGGCTGTCTTTGAG

CCAGAG CGTAAGAAGAGTGCAGTCACTTACCTTAACAGCACAATGCATCCTGGGACGCGGAAGAGAG CCAATGAGGAACACTGGCCAAAG GGTGATA

TCCATGAGGATTTTTGCAGTGTTTGCAGAAAAAGTGGCCAGTTGCTGATGTGTGACACGTGTTCCCGTGTGTATCATCTGGACTGCTTAGAGCCGCCCCT

GAAAACAATTCCCAAGGGCATGTGGATCTGTCCCAGATGTCAGGACCAG - UNI20910 - ATGCTAAAGAAGGAAGAAGCAATTCCTTGGCCTGGAA

CCTTAGCCATTGTTCATTCCTACATCGCCTACAAAGCAG CAAAAGAAGAGGAGAAACAGAAGCTACTTAAGTGGAGTTCAGATTTAAAACAGGAGCGGG

AACAACTGGAGCAGAAGGTCAAAGAGCTCAGCAGTTCTATAAGT AAATGTATGGAGATGAAGAGCAGCATCCTGGCGCGGCAGAAGGAGATGCGCAGCT

CCCTGGACAAGGTGAAGCGGCTCATCCGCCTTGTGCATGGCGTCGACCTCTGCAGACCTGTGGACTCAGAGGCCACGGCGGGGGCCCTCTCCAATGGCCC

AGACTGCACTCCCCCTGCCAACGCCGCCTCCACACCCGCCCCTTCCCCCTCCTCGCAGAGCTGCACAGCGAACTGTAACCAGGGGGAAGAGACTAAATAA

CAGAGCCCTCGAGGCGGACATGCCACAGTCCTGGTGGCGAGGAGACGCTAGAAGAGCAAAGCCGGATTTCTTCTGGAAAGTACAGAGTTCTTTTGGTTCT

TTGGTTCCAGAGAGAGAGAAGATGCTTGTGCCAGGTGGCACCCGAGTTTGCCAATTGATTCTTGTTATTCTGTGTGTACATGCAAAGACTGGACCATGTT

ACATGAAATAGTGCCAGCTGGAGGTTCTTTGCCAGCACCATGCCAAGTGACATAATATATTACTCTCTCTATTATACACCAGTGTGTGCCTGCAGCAGCC

TCCACAGCCACGGTGGGTTCGTTTTTGTTTTGTTGGGTGGGGAGCAGGGACGGGCGGAGGGAGGAGAGCAGGTTTCAGATCCTTACTGGGAGCCGTTTGT

TTAGGTAGAAAGACAAGTCCAAAGAGTGTGTGGGCTTTCCTGTTCCTAAACTTTTCACTACCATAAAACCAAAAAACGAAAAAAAAAGAAAAAAAGATAA

AAAAGGAAATAGAGATTTAACTAACCCAGTGCCCAGAAGAGGGACGGGAAGGGCTGGGAGGGGGCAAGGGTGGGAAAGTATATGACATAAGCAGTATTTA

ACGTTCCTGGAGGGGCCGAAGTGCAAGAGGAGAGCCCCGCCCCTCCCTAGCTCGCCCCGCCCACAGCCTCCAGCAGCCCCTCCCCTCTGCTTGGTGTAGT

GCAGAGCCCGGGTGGTTCTAGGCCTTGTTAAGCAGGGAAGGGAGGGTGCGAGGGGTCCGGAGGGAGAAAGGCGGATCAGAGGTTTACTTGAAAACAAGCT

CCATCCCTTTTCTATATTTATAAGAAGAGAAGGTTCTAAGCAGAGCAGCACGACCCAGGTGTGTGTGAATGGAGACAACCCTTTTCTCTTCTTCAAGTTT

ATTTTGTTTCTGTTCTTGTTTTGTTTAAACAAAGTTTTGTTTTGTTGTTTATTTTTCCTTTCTTTCTTTCTTTCTTTCTTTCTTTCTTTCTTTTTAACAA

GAACTAAAATAAGAAATAGAAAAGCTGTTTTTTCAGGCTGACGGTCCTGTTGAGGGTAGCGGAGACCTTGCATGATAGAGTAGGCGTCATAGTGTCAAGT

GAGGTCGGTGAGTCTGTGTGCGTCCTGTGTCATCAGTCAGGCACTGTTCTGGTTTGTTTGTTTTGTTTTTTACTTTCTGGTTTTGTTTTCTGGTTTTGTT

TTTTGTTTTTTCATGCAAGGGCAAAAAAAAAAATCTTTGTACCTGGGGAAAACAACTTTTTTTTTATTAAAAAGGAAAATAAAAGATATTGAGGTCTTCC

TAGTGTTACTTAAATTAAGATCAAGGTAAGAAACATTGTAAAAATTACAAAAGTGCTATTTGTTTCCTAAAAACAGTGATTTTTATTAAAAAGGTGTCAG

AACTGG
Translation
 - UNI14434 - - UNI34655 -  - UNI3188 - - UNI16699 - - UNI20077 - MELQTLQEALKVEIQVHQ - UNI3188 - - U

NI16699 - - UNI22192 - KLVAQMKQDPQ - UNI22192 - - UNI23759 - NADLKKQLHELQAKITALSEKQ - UNI7400 - - UN

I26419 - KRVVEQLRKNLIVKQEQPDKFQIQPLSQSENKLQTAQQQPLQPLQQQQPQQPQQQQQQQQQHAQQSAAAPPSLTASQ - UNI26419 - 

KTVTTASMITTKTLPLVLKAATATMPASVVGQRPTIAMVTAINSQKAVLSTDVQNTPVNLQTSSKVTGPGAEAVQIVAKNTVTL QVQATPPQPIKVPQF

IPPPRLTPRPNFLPQ VRPKPVAQNNIPIAPAPPPMLAAPQLIQRPVMLTKFTPTTLPTSQNSIHPVRVVNGQTATIAKTFPMAQLTSIVIATPGTRLPG

PQTVQLSKPSLEKQ TVKSHPEAEEKQAESRTVTPPAAPKPKREENPQ KLAFMVSLGLVTHDHLEE EIQSKRQERKRRTTANPVYSGAVFEPE RKKS

AVTYLNSTMHPGTRKRA ANEEHWPK GDIHEDFCSVCRKSGQLLMCDTCSRVYHLDCLEPPLKTIPKGMWICPRCQDQ - UNI20910 - MLKKEEA

IPWPGTLAIVHSYIAYKAA AKEEEKQKLLKWSSDLKQEREQLEQKVKELSSSIS KCMEMKSSILARQKEMRSSLDKVKRLIRLVHGVDLCRPVDSEAT

AGALSNGPDCTPPANAASTPAPSPSSQSCTANCNQGEETK
Transcript ENSMUST00000111293
Sequence
AGCAGCAGCAGAAGCAGCAGCGGCAGCTCCAGCCTCTTCCCTCCCTCCCCATGAAGAAGAGTTCCCTCCTCCTCCTCCTCCTGCTTCTCCTGCTCAGAGT

TCCTGCCTCCAGCTGCCAGGGGGGACAGCCAGCCAGCAGCAGGAGG - UNI14434 - - UNI34655 - GGGACTGGAGAGCTGAAGGAGCGCCAG

CTTCTCCAGAATTG - UNI20077 - GACTTCTCAGAACCTTTAATATGCTAATGTGCATTGTGAATCTCCAAGATGGGGATATGATATGCAGCATTC

TTGAATACTTCTAATGACAGGGAGCCCACTACCTCATAAG - UNI3188 - - UNI16699 - CTGCAGCAACAAGAGGAGCTTGTAATTTTAAACG

GAGGCTGAAGACACTGTAGAATTAGCAGACATAAGAGAGCGTGGAGAAGGCAGAGGATGGAGTTGCAGACTCTACAGGAGGCTCTTAAAGTGGAAATTCA

GGTTCACCAG - UNI3188 - - UNI16699 - - UNI22192 - AAACTGGTTGCCCAAATGAAGCAGGATCCACAG - UNI22192 - - UN

I23759 - AATGCTGACTTAAAGAAACAGCTTCATGAACTCCAAGCCAAAATCACAGCTTTGAGTGAGAAACAG - UNI7400 - - UNI26419 -

 AAAAGAGTAGTTGAGCAGCTGCGCAAGAACCTGATAGTCAAACAAGAGCAGCCGGACAAGTTCCAGATACAGCCATTGTCACAGTCTGAAAACAAACTA

CAAACAGCACAGCAGCAGCCACTACAGCCACTGCAGCAGCAGCAACCGCAGCAACCGCAGCAGCAGCAGCAGCAGCAGCAGCAGCACGCCCAGCAGTCAG

CAGCAGCACCGCCTAGTCTAACTGCATCACAG - UNI26419 - AAGACTGTAACTACAGCTTCTATGATTACCACAAAGACACTACCTCTCGTCTTG

AAAGCAGCAACTGCGACCATGCCTGCCTCTGTTGTGGGCCAGAGACCTACCATTGCTATGGTGACCGCCATCAACAGCCAGAAGGCTGTGCTCAGCACTG

ATGTGCAGAACACACCAGTCAACCTCCAGACGTCTAGTAAGGTCACTGGGCCTGGGGCAGAGGCTGTCCAAATTGTGGCAAAAAACACAGTCACTCTG C

AGGTTCAAGCAACACCTCCTCAGCCCATCAAAGTACCACAGTTTATCCCTCCTCCTAGACTCACTCCACGCCCAAACTTCCTTCCACAG GTTCGACCCA

AGCCTGTGGCCCAGAATAACATTCCTATCGCTCCAGCGCCTCCTCCCATGCTTGCAGCTCCTCAGCTTATCCAGAGGCCTGTCATGCTGACCAAGTTTAC

ACCCACAACCCTCCCCACATCCCAGAATTCCATCCACCCTGTCCGTGTTGTCAATGGACAGACTGCAACCATAGCCAAAACGTTCCCCATGGCCCAGCTC

ACCAGCATTGTCATAGCTACTCCAGGGACCAGACTCCCTGGACCTCAGACTGTACAGCTTAGCAAACCAAGCCTGGAGAAACAG ACAGTTAAATCCCAC

CCAGAAGCAGAGGAAAAACAAGCAGAGAGCCGTACCGTTACCCCACCTGCTGCACCAAAACCAAAACGAGAAGAGAACCCTCAG AAACTTGCCTTCATG

GTGTCTCTAGGGTTGGTAACACATGACCATCTAGAAG AAATCCAAAGCAAGAGGCAGGAAAGAAAGAGAAGAACAACAGCAAACCCGGTGTACAGTGGG

GCTGTCTTTGAGCCAGAG CGTAAGAAGAGTGCAGTCACTTACCTTAACAGCACAATGCATCCTGGGACGCGGAAGAGAG GTCGTCCTCCAAAATACAA

TGCGGTGCTGGGGTTTGGAGCCCTTACCCCAACATCCCCCCCATCCAGTCATCCCGACTCCCCTGAAAATGAAAAGACAGAGACCACATTCACTTTCCCT

GCACCTGTTCAGCCTGTGTCTTTGCCCAGCCCCACCTCCACAGAC GGTGATATCCATGAGGATTTTTGCAGTGTTTGCAGAAAAAGTGGCCAGTTGCTG

ATGTGTGACACGTGTTCCCGTGTGTATCATCTGGACTGCTTAGAGCCGCCCCTGAAAACAATTCCCAAGGGCATGTGGATCTGTCCCAGATGTCAGGACC

AG - UNI20910 - ATGCTAAAGAAGGAAGAAGCAATTCCTTGGCCTGGAACCTTAGCCATTGTTCATTCCTACATCGCCTACAAAGCAG CAAAAGA

AGAGGAGAAACAGAAGCTACTTAAGTGGAGTTCAGATTTAAAACAGGAGCGGGAACAACTGGAGCAGAAGGTCAAAGAGCTCAGCAGTTCTATAAGT AA

ATGTATGGAGATGAAGAGCAGCATCCTGGCGCGGCAGAAGGAGATGCGCAGCTCCCTGGACAAGGTGAAGCGGCTCATCCGCCTTGTGCATGGCGTCGAC

CTCTGCAGACCTGTGGACTCAGAGGCCACGGCGGGGGCCCTCTCCAATGGCCCAGACTGCACTCCCCCTGCCAACGCCGCCTCCACACCCGCCCCTTCCC

CCTCCTCGCAGAGCTGCACAGCGAACTGTAACCAGGGGGAAGAGACTAAATAACAGAGCCCTCGAGGCGGACATGCCACAGTCCTGGTGGCGAGGAGACG

CTAGAAGAGCAAAGCCGGATTTCTTCTGGAAAGTACAGAGTTCTTTTGGTTCTTTGGTTCCAGAGAGAGAGAAGATGCTTGTGCCAGGTGGCACCCGAGT

TTGCCAATTGATTCTTGTTATTCTGTGTGTACATGCAAAGACTGGACCATGTTACATGAAATAGTGCCAGCTGGAGGTTCTTTGCCAGCACCATGCCAAG

TGACATAATATATTACTCTCTCTATTATACACCAGTGTGTGCCTGCAGCAGCCTCCACAGCCACGGTGGGTTCGTTTTTGTTTTGTTGGGTGGGGAGCAG

GGACGGGCGGAGGGAGGAGAGCAGGTTTCAGATCCTTACTGGGAGCCGTTTGTTTAGGTAGAAAGACAAGTCCAAAGAGTGTGTGGGCTTTCCTGTTCCT

AAACTTTTCACTACCATAAAACCAAAAAACGAAAAAAAAAGAAAAAAAGATAAAAAAGGAAATAGAGATTTAACTAACCCAGTGCCCAGAAGAGGGACGG

GAAGGGCTGGGAGGGGGCAAGGGTGGGAAAGTATATGACATAAGCAGTATTTAACGTTCCTGGAGGGGCCGAAGTGCAAGAGGAGAGCCCCGCCCCTCCC

TAGCTCGCCCCGCCCACAGCCTCCAGCAGCCCCTCCCCTCTGCTTGGTGTAGTGCAGAGCCCGGGTGGTTCTAGGCCTTGTTAAGCAGGGAAGGGAGGGT

GCGAGGGGTCCGGAGGGAGAAAGGCGGATCAGAGGTTTACTTGAAAACAAGCTCCATCCCTTTTCTATATTTATAAGAAGAGAAGGTTCTAAGCAGAGCA

GCACGACCCAGGTGTGTGTGAATGGAGACAACCCTTTTCTCTTCTTCAAGTTTATTTTGTTTCTGTTCTTGTTTTGTTTAAACAAAGTTTTGTTTTGTTG

TTTATTTTTCCTTTCTTTCTTTCTTTCTTTCTTTCTTTCTTTCTTTTTAACAAGAACTAAAATAAGAAATAGAAAAGCTGTTTTTTCAGGCTGACGGTCC

TGTTGAGGGTAGCGGAGACCTTGCATGATAGAGTAGGCGTCATAGTGTCAAGTGAGGTCGGTGAGTCTGTGTGCGTCCTGTGTCATCAGTCAGGCACTGT

TCTGGTTTGTTTGTTTTGTTTTTTACTTTCTGGTTTTGTTTTCTGGTTTTGTTTTTTGTTTTTTCATGCAAGGGCAAAAAAAAAAATCTTTGTACCTGGG

GAAAACAACTTTTTTTTTATTAAAAAGGAAAATAAAAGATATTGAGGTCTTCCTAGTGTTACTTAAATTAAGATCAAGGTAAGAAACATTGTAAAAATTA

CAAAAGTGCTATTTGTTTCCTAAAAACAGTGATTTTTATTAAAAAGGTGTCAGAACTGGAGAAAACGCTGTGTAGTGACAGTTTTTTAGCACAGAGCCTA

CTGATCCTGATGACATTTTACTGTGTTGTATCTCTAGACTGGTGTGCCAGTTTCCTGCAGGGCCGGGTCCGCCCCCTCCTCGCTCCTCCCTACTCAGACT

TGCTGTCTCCTTGGTACAGGGATCTCATCTCCTGTTTGAAGCCAAAATGGAATGTGCATAGTGTCAGGGCGTTCCCACGGTCTCAGACCTTGCTAGAACG

CAGGCTGGTGCCCACCTAGCCCTTCCCTTGGTGCTGCTCTGTCTTACAGCCACCAGCATTACTTATGCCTCGGGGGCCCCTTGGGGGACTGACCAGTGAG

GCTCCTCACTGCCTGTATACTTGGCCTCCAGGAGGGTATAGGATGCAGGCTGGCTGCATCAGGGAGGAAATGCTTTGAGAGTCCGTATGTCTCTAAGAGC

CCAGGTAGCCTTCAAGTCCATCTTGCGTTAAAGAGAGAAATCTGAAGCTCTAGGGGGTCTCTGCCTGCCCGCCCCAAGGTCAGAGTTCACTCCCATTCCA

CTCACTCACATGCTTCCTGGGTGTTCCTGGGCTAGAATCACTATGCTTGCCTTGTGTGGCCTAGTGTAGACTTTTCTTCTTGGAAAAATGGGGTTCTGAA

AGGCTCTCTACTCATCTCCCCGACAATACCATAGGGAACATAACTCTACGAGACGCATGCTCCCAGTGGAAATCTTTATCTGATCCATGTCCTTGAGTGA

AGGGACAGAGACCTAGGCTCTACCCCCAGGTCTGAAAGCAGCATCTCTCTGAGCCCGCCAGGCTCCCAAGTCTAGGAGTAGCAGGAAAGACCCCTTTGCT

TCTTCCTTGCCCAGTTAGGTCCATGGAAAATGAGCTGGATCCTGACTGAAACTACAGCAGACAAGAGGTGCTTGTGAGAGTGAGCCAGGCCCATCCACAC

CAGCCACCCATTCACTTCCCAGCGTTTGAGAAGAGGGCAGGTAGTCTGGCCACACAGGCCTCAGCTTCAGGCCTCTGGCTTCAGGTTGACTGAGGGGAGC

AGAGAAAAGCCCTCTTTTCTTATTTAGGAACTAAGGTGCTGTCTAGTTAGCGGGCGTTGGAGATGCCTGGACTAGTTGGATCTTTGGCAGAGGATCAGAG

ACCAGCTGCAGGCTGATATCCTGTCTCAGCTCCCCCAACCTGCCAACCCCCTGTTGGACTTGTCTGGGCCCATAGGCTGGGGCTTGGCACATACTACCTA

CCTGTGATGGGAAGAGGTTGACAAGCCATCAACAATCACTACAGGCCTTTGCTCCAGAAGAGCTGCTGGTGGCAGCACGAGACCCGAGCAGCATAGACTC

CCATCTTCTGATGTTTGGAAATGAGTTGCTTTGAGTCAACTGGAGTGAAGTAAAAAAATGTAGCCCTGCTCCAAGCCTCCACTGTGGGTCCTGCCCCTTC

CGTCTACTTGCCCTTACCTCTGTCAGCACAAAGCTCTTCTCTGTCCCTTTAGACCTGTGCGTACCTGGGACCACCTGGGACATACACACACACTGCCCCT

TCAGAGCCGCTTCCAAGCTCCCATCCTCCCTCCCCTACCTGCGTGTGTTGCTCTTGTAGCCACATGTGTAAGGCTCGCTAGCATGGCAGTCACTTTGGAG

GGCCTTGGACTGGGAGTCCCCTTGTCCCCAGGGTCAGGCTGGCAGGTGTAGGCCATAGAGGTCAGCACCATCGCCTTCCTCCCCTAAAGGGTCCTCTCTC

TTTCTGAGCCACTGTCTTGTCTGCCTCCGCTGAGCTTAACCAGTTCTCGTTTTTTCCCTTGCTTGTCTGGCTTTGGGAGGTAAGGCTGCTGATGACGTCC

TTCAAGAAAGTCTCAGAAGCAGTCCCCGATGGCTTTACCTGAGTAGGGCCTGCCTCTATAGGCAGTAACAGCCACAGGCAGCCTCCAGCTGGCCCCCATC

TTAGTGACTGGCATCCTCTTAGGGGCACCTCTCCTGCTGCTGCTTCTTGTCTCATGCCCATCAGGCAGTGGTAAGGTACATGTGTACCCAGCACTGCCCA

AGCGACTGTGTCTCCAGCTGTCTGTCTACACCTACAGCTGCCTCTCTGCCGCCTCTCTGATGCTTCCTCTTGGGGCTTGACTTCTTGACTCTCCCTACCA

GCCCCCTCCCTCCAGCTCACAACCTTTAAATGGTCTCTTCCCTTTAGGCCCTCCTTTGGTATGGACCTTACCTAACTAAAGGGCTGAACTCTTGAGGACA

TTCCTCCCAGGGGCAGGAGTAGGACGGACCAGTTGGTCCTTCTCTGGACACTGGGTTCTCCAGACCCCATGGCTTCTGTTGAATGCAGGCTACTTTGCTC

TGTGTAAATGATTGTGGACCTTGTCCCACCCCACATCCCAGCACCCCTGGCAGAAAACAGGAGTATCACTTCTCATCCTACCTTTAGCCGGTGCTCCTGG

TCAGCTCCTCCCCGAGAAGGAATTGGGTGACCCCTAGGGAAGATTCCACTGGTCCTCCCCAGGGAATGAAGAGTCCCACCTGGCAGCCTTGGCCCCTGCA

CCCCTCTCCAGTGTTCTTGCTCTTAGCCCAGGGTGAGTTGCAGTCAGGTGGGTGGGCTGAGCAGACCAGAAGTCAGCAAGCTCCACCACGCATACAGCCA

GCCAGACCCAGTCCTGTCTGTGTCCATGCCCTTTGTGATTTCAGTCTTGGTAGAATTTGTATTTGGAGTTTTGTGCTTCAAAGTTTCTGTTTCATTTGTT

CGGTTTTTGTTTCGAGGGGGTGGGGGGTACAGAGCAGCCGATCAATTTGTATTTATTTATTTTAACATTTTACTAAATAAAGCCAAATGAAGCCT
Translation
 - UNI14434 - - UNI34655 -  - UNI20077 -  - UNI3188 - - UNI16699 - MELQTLQEALKVEIQVHQ - UNI3188 - - 

UNI16699 - - UNI22192 - KLVAQMKQDPQ - UNI22192 - - UNI23759 - NADLKKQLHELQAKITALSEKQ - UNI7400 - - U

NI26419 - KRVVEQLRKNLIVKQEQPDKFQIQPLSQSENKLQTAQQQPLQPLQQQQPQQPQQQQQQQQQHAQQSAAAPPSLTASQ - UNI26419 -

 KTVTTASMITTKTLPLVLKAATATMPASVVGQRPTIAMVTAINSQKAVLSTDVQNTPVNLQTSSKVTGPGAEAVQIVAKNTVTL QVQATPPQPIKVPQ

FIPPPRLTPRPNFLPQ VRPKPVAQNNIPIAPAPPPMLAAPQLIQRPVMLTKFTPTTLPTSQNSIHPVRVVNGQTATIAKTFPMAQLTSIVIATPGTRLP

GPQTVQLSKPSLEKQ TVKSHPEAEEKQAESRTVTPPAAPKPKREENPQ KLAFMVSLGLVTHDHLEE EIQSKRQERKRRTTANPVYSGAVFEPE RKK

SAVTYLNSTMHPGTRKRG GRPPKYNAVLGFGALTPTSPPSSHPDSPENEKTETTFTFPAPVQPVSLPSPTSTD GDIHEDFCSVCRKSGQLLMCDTCSR

VYHLDCLEPPLKTIPKGMWICPRCQDQ - UNI20910 - MLKKEEAIPWPGTLAIVHSYIAYKAA AKEEEKQKLLKWSSDLKQEREQLEQKVKELSS

SIS KCMEMKSSILARQKEMRSSLDKVKRLIRLVHGVDLCRPVDSEATAGALSNGPDCTPPANAASTPAPSPSSQSCTANCNQGEETK
Transcript ENSMUST00000111292
Sequence
TCCTCCTCCTCCTGCTTCTCCTGCTCAGAGTTCCTGCCTCCAGCTGCCAGGGGGGACAGCCAGCCAGCAGCAGGAGG - UNI14434 - - UNI3465

5 - GGGACTGGAGAGCTGAAGGAGCGCCAGCTTCTCCAGAATTG - UNI20077 - GACTTCTCAGAACCTTTAATATGCTAATGTGCATTGTGAAT

CTCCAAGATGGGGATATGATATGCAGCATTCTTGAATACTTCTAATGACAGGGAGCCCACTACCTCATAAG - UNI3188 - - UNI16699 - CTG

CAGCAACAAGAGGAGCTTGTAATTTTAAACGGAGGCTGAAGACACTGTAGAATTAGCAGACATAAGAGAGCGTGGAGAAGGCAGAGGATGGAGTTGCAGA

CTCTACAGGAGGCTCTTAAAGTGGAAATTCAGGTTCACCAG - UNI3188 - - UNI16699 - - UNI22192 - AAACTGGTTGCCCAAATGAA

GCAGGATCCACAG - UNI22192 - - UNI23759 - AATGCTGACTTAAAGAAACAGCTTCATGAACTCCAAGCCAAAATCACAGCTTTGAGTGAG

AAACAG - UNI7400 - - UNI26419 - AAAAGAGTAGTTGAGCAGCTGCGCAAGAACCTGATAGTCAAACAAGAGCAGCCGGACAAGTTCCAGAT

ACAGCCATTGTCACAGTCTGAAAACAAACTACAAACAGCACAGCAGCAGCCACTACAGCCACTGCAGCAGCAGCAACCGCAGCAACCGCAGCAGCAGCAG

CAGCAGCAGCAGCAGCACGCCCAGCAGTCAGCAGCAGCACCGCCTAGTCTAACTGCATCACAG - UNI26419 - GTTCAAGCAACACCTCCTCAGCC

CATCAAAGTACCACAGTTTATCCCTCCTCCTAGACTCACTCCACGCCCAAACTTCCTTCCACAG GTTCGACCCAAGCCTGTGGCCCAGAATAACATTCC

TATCGCTCCAGCGCCTCCTCCCATGCTTGCAGCTCCTCAGCTTATCCAGAGGCCTGTCATGCTGACCAAGTTTACACCCACAACCCTCCCCACATCCCAG

AATTCCATCCACCCTGTCCGTGTTGTCAATGGACAGACTGCAACCATAGCCAAAACGTTCCCCATGGCCCAGCTCACCAGCATTGTCATAGCTACTCCAG

GGACCAGACTCCCTGGACCTCAGACTGTACAGCTTAGCAAACCAAGCCTGGAGAAACAG ACAGTTAAATCCCACCCAGAAGCAGAGGAAAAACAAGCAG

AGAGCCGTACCGTTACCCCACCTGCTGCACCAAAACCAAAACGAGAAGAGAACCCTCAG AAACTTGCCTTCATGGTGTCTCTAGGGTTGGTAACACATG

ACCATCTAGAAG AAATCCAAAGCAAGAGGCAGGAAAGAAAGAGAAGAACAACAGCAAACCCGGTGTACAGTGGGGCTGTCTTTGAGCCAGAG CGTAAG

AAGAGTGCAGTCACTTACCTTAACAGCACAATGCATCCTGGGACGCGGAAGAGAG CCAATGAGGAACACTGGCCAAAG GGTGATATCCATGAGGATTT

TTGCAGTGTTTGCAGAAAAAGTGGCCAGTTGCTGATGTGTGACACGTGTTCCCGTGTGTATCATCTGGACTGCTTAGAGCCGCCCCTGAAAACAATTCCC

AAGGGCATGTGGATCTGTCCCAGATGTCAGGACCAG - UNI20910 - ATGCTAAAGAAGGAAGAAGCAATTCCTTGGCCTGGAACCTTAGCCATTGT

TCATTCCTACATCGCCTACAAAGCAG CAAAAGAAGAGGAGAAACAGAAGCTACTTAAGTGGAGTTCAGATTTAAAACAGGAGCGGGAACAACTGGAGCA

GAAGGTCAAAGAGCTCAGCAGTTCTATAAGT AAATGTATGGAGATGAAGAGCAGCATCCTGGCGCGGCAGAAGGAGATGCGCAGCTCCCTGGACAAGGT

GAAGCGGCTCATCCGCCTTGTGCATGGCGTCGACCTCTGCAGACCTGTGGACTCAGAGGCCACGGCGGGGGCCCTCTCCAATGGCCCAGACTGCACTCCC

CCTGCCAACGCCGCCTCCACACCCGCCCCTTCCCCCTCCTCGCAGAGCTGCACAGCGAACTGTAACCAGGGGGAAGAGACTAAATAACAGAGCCCTCGAG

GCGGACATGCCACAGTCCTGGTGGCGAGGAGACGCTAGAAGAGCAAAGCCGGATTTCTTCTGGAAAGTACAGAGTTCTTTTGGTTCTTTGGTTCCAGAGA

GAGAGAAGATGCTTGTGCCAGGTGGCACCCGAGTTTGCCAATTGATTCTTGTTATTCTGTGTGTACATGCAAAGACTGGACCATGTTACATGAAATAGTG

CCAGCTGGAGGTTCTTTGCCAGCACCATGCCAAGTGACATAATATATTACTCTCTCTATTATACACCAGTGTGTGCCTGCAGCAGCCTCCACAGCCACGG

TGGGTTCGTTTTTGTTTTGTTGGGTGGGGAGCAGGGACGGGCGGAGGGAGGAGAGCAGGTTTCAGATCCTTACTGGGAGCCGTTTGTTTAGGTAGAAAGA

CAAGTCCAAAGAGTGTGTGGGCTTTCCTGTTCCTAAACTTTTCACTACCATAAAACC
Translation
 - UNI14434 - - UNI34655 -  - UNI20077 -  - UNI3188 - - UNI16699 - MELQTLQEALKVEIQVHQ - UNI3188 - - 

UNI16699 - - UNI22192 - KLVAQMKQDPQ - UNI22192 - - UNI23759 - NADLKKQLHELQAKITALSEKQ - UNI7400 - - U

NI26419 - KRVVEQLRKNLIVKQEQPDKFQIQPLSQSENKLQTAQQQPLQPLQQQQPQQPQQQQQQQQQHAQQSAAAPPSLTASQ - UNI26419 -

 VQATPPQPIKVPQFIPPPRLTPRPNFLPQ VRPKPVAQNNIPIAPAPPPMLAAPQLIQRPVMLTKFTPTTLPTSQNSIHPVRVVNGQTATIAKTFPMAQ

LTSIVIATPGTRLPGPQTVQLSKPSLEKQ TVKSHPEAEEKQAESRTVTPPAAPKPKREENPQ KLAFMVSLGLVTHDHLEE EIQSKRQERKRRTTANP

VYSGAVFEPE RKKSAVTYLNSTMHPGTRKRA ANEEHWPK GDIHEDFCSVCRKSGQLLMCDTCSRVYHLDCLEPPLKTIPKGMWICPRCQDQ - UNI

20910 - MLKKEEAIPWPGTLAIVHSYIAYKAA AKEEEKQKLLKWSSDLKQEREQLEQKVKELSSSIS KCMEMKSSILARQKEMRSSLDKVKRLIRL

VHGVDLCRPVDSEATAGALSNGPDCTPPANAASTPAPSPSSQSCTANCNQGEETK
Transcript ENSMUST00000111291
Sequence
TCTTTATTCTGCTGAGCGGTGCTGTTAGGATTTCTTTCTCTCTCTCTCTTCGCTCGCTCTCTTTTTTTTCCTACCTCCTCTTCCTCCCTTGACCACGCTC

GCAATG CCTTGTAGGAAAGAATTACTGATTTTTCCCTGGGAATACTGTTACTTATTTTAATTTCG - UNI14434 - GGGACTGGAGAGCTGAAGGA

GCGCCAGCTTCTCCAGAATTG - UNI20077 - GACTTCTCAGAACCTTTAATATGCTAATGTGCATTGTGAATCTCCAAGATGGGGATATGATATGC

AGCATTCTTGAATACTTCTAATGACAGGGAGCCCACTACCTCATAAG - UNI3188 - - UNI16699 - CTGCAGCAACAAGAGGAGCTTGTAATT

TTAAACGGAGGCTGAAGACACTGTAGAATTAGCAGACATAAGAGAGCGTGGAGAAGGCAGAGGATGGAGTTGCAGACTCTACAGGAGGCTCTTAAAGTGG

AAATTCAGGTTCACCAG - UNI3188 - - UNI16699 - - UNI22192 - AAACTGGTTGCCCAAATGAAGCAGGATCCACAG - UNI22192

 - - UNI23759 - AATGCTGACTTAAAGAAACAGCTTCATGAACTCCAAGCCAAAATCACAGCTTTGAGTGAGAAACAG - UNI7400 - - UNI

26419 - AAAAGAGTAGTTGAGCAGCTGCGCAAGAACCTGATAGTCAAACAAGAGCAGCCGGACAAGTTCCAGATACAGCCATTGTCACAGTCTGAAAA

CAAACTACAAACAGCACAGCAGCAGCCACTACAGCCACTGCAGCAGCAGCAACCGCAGCAACCGCAGCAGCAGCAGCAGCAGCAGCAGCAGCACGCCCAG

CAGTCAGCAGCAGCACCGCCTAGTCTAACTGCATCACAG - UNI26419 - GTTCAAGCAACACCTCCTCAGCCCATCAAAGTACCACAGTTTATCCC

TCCTCCTAGACTCACTCCACGCCCAAACTTCCTTCCACAG GTTCGACCCAAGCCTGTGGCCCAGAATAACATTCCTATCGCTCCAGCGCCTCCTCCCAT

GCTTGCAGCTCCTCAGCTTATCCAGAGGCCTGTCATGCTGACCAAGTTTACACCCACAACCCTCCCCACATCCCAGAATTCCATCCACCCTGTCCGTGTT

GTCAATGGACAGACTGCAACCATAGCCAAAACGTTCCCCATGGCCCAGCTCACCAGCATTGTCATAGCTACTCCAGGGACCAGACTCCCTGGACCTCAGA

CTGTACAGCTTAGCAAACCAAGCCTGGAGAAACAG ACAGTTAAATCCCACCCAGAAGCAGAGGAAAAACAAGCAGAGAGCCGTACCGTTACCCCACCTG

CTGCACCAAAACCAAAACGAGAAGAGAACCCTCAG AAACTTGCCTTCATGGTGTCTCTAGGGTTGGTAACACATGACCATCTAGAAG AAATCCAAAGC

AAGAGGCAGGAAAGAAAGAGAAGAACAACAGCAAACCCGGTGTACAGTGGGGCTGTCTTTGAGCCAGAG CGTAAGAAGAGTGCAGTCACTTACCTTAAC

AGCACAATGCATCCTGGGACGCGGAAGAGAG GTCGTCCTCCAAAATACAATGCGGTGCTGGGGTTTGGAGCCCTTACCCCAACATCCCCCCCATCCAGT

CATCCCGACTCCCCTGAAAATGAAAAGACAGAGACCACATTCACTTTCCCTGCACCTGTTCAGCCTGTGTCTTTGCCCAGCCCCACCTCCACAGAC GGT

GATATCCATGAGGATTTTTGCAGTGTTTGCAGAAAAAGTGGCCAGTTGCTGATGTGTGACACGTGTTCCCGTGTGTATCATCTGGACTGCTTAGAGCCGC

CCCTGAAAACAATTCCCAAGGGCATGTGGATCTGTCCCAGATGTCAGGACCAG - UNI20910 - ATGCTAAAGAAGGAAGAAGCAATTCCTTGGCCT

GGAACCTTAGCCATTGTTCATTCCTACATCGCCTACAAAGCAG CAAAAGAAGAGGAGAAACAGAAGCTACTTAAGTGGAGTTCAGATTTAAAACAGGAG

CGGGAACAACTGGAGCAGAAGGTCAAAGAGCTCAGCAGTTCTATAAGT AAATGTATGGAGATGAAGAGCAGCATCCTGGCGCGGCAGAAGGAGATGCGC

AGCTCCCTGGACAAGGTGAAGCGGCTCATCCGCCTTGTGCATGGCGTCGACCTCTGCAGACCTGTGGACTCAGAGGCCACGGCGGGGGCCCTCTCCAATG

GCCCAGACTGCACTCCCCCTGCCAACGCCGCCTCCACACCCGCCCCTTCCCCCTCCTCGCAGAGCTGCACAGCGAACTGTAACCAGGGGGAAGAGACTAA

ATAACAGAGCCCTCGAGGCGGACATGCCACAGTCCTGGTGGCGAGGAGACGCTAGAAGAGCAAAGCCGGATTTCTTCTGGAAAGTACAGAGTTCTTTTGG

TTCTTTGGTTCCAGAGAGAGAGAAGATGCTTGTGCCAGGTGGCACCCGAGTTTGCCAATTGATTCTTGTTATTCTGTGTGTACATGCAAAGACTGGACCA

TGTTACATGAAATAGTGCCAGCTGGAGGTTCTTTGCCAGCACCATGCCAAGTGACATAATATATTACTCTCTCTATTATACACCAGTGTGTGCCTGCAGC

AGCCTCCACAGCCACGGTGGGTTCGTTTTTGTTTTGTTGGGTGGGGAGCAGGGACGGGCGGAGGGAGGAGAGCAGGTTTCAGATCCTTACTGGGAGCCGT

TTGTTTAGGTAGAAAGACAAGTCCAAAGAGTGTGTGGGCTTTCCTGTTCCTAAACTTTTCACTACCATAAAACCAAAAAACG
Translation
  - UNI14434 -  - UNI20077 -  - UNI3188 - - UNI16699 - MELQTLQEALKVEIQVHQ - UNI3188 - - UNI16699 - -

 UNI22192 - KLVAQMKQDPQ - UNI22192 - - UNI23759 - NADLKKQLHELQAKITALSEKQ - UNI7400 - - UNI26419 - KR

VVEQLRKNLIVKQEQPDKFQIQPLSQSENKLQTAQQQPLQPLQQQQPQQPQQQQQQQQQHAQQSAAAPPSLTASQ - UNI26419 - VQATPPQPIKV

PQFIPPPRLTPRPNFLPQ VRPKPVAQNNIPIAPAPPPMLAAPQLIQRPVMLTKFTPTTLPTSQNSIHPVRVVNGQTATIAKTFPMAQLTSIVIATPGTR

LPGPQTVQLSKPSLEKQ TVKSHPEAEEKQAESRTVTPPAAPKPKREENPQ KLAFMVSLGLVTHDHLEE EIQSKRQERKRRTTANPVYSGAVFEPE R

KKSAVTYLNSTMHPGTRKRG GRPPKYNAVLGFGALTPTSPPSSHPDSPENEKTETTFTFPAPVQPVSLPSPTSTD GDIHEDFCSVCRKSGQLLMCDTC

SRVYHLDCLEPPLKTIPKGMWICPRCQDQ - UNI20910 - MLKKEEAIPWPGTLAIVHSYIAYKAA AKEEEKQKLLKWSSDLKQEREQLEQKVKEL

SSSIS KCMEMKSSILARQKEMRSSLDKVKRLIRLVHGVDLCRPVDSEATAGALSNGPDCTPPANAASTPAPSPSSQSCTANCNQGEETK
Transcript ENSMUST00000111290
Sequence
TGAGAACAACAACAAAAACTGAGCCCACTACCTCATA - UNI3188 - - UNI14434 - - UNI16699 - - UNI20077 - - UNI31455 

- - UNI34655 - AGCTGCAGCAACAAGAGGAGCTTGTAATTTTAAACGGAGGCTGAAGACACTGTAGAATTAGCAGACATAAGAGAGCGTGGAGAAG

GCAGAGGATGGAGTTGCAGACTCTACAGGAGGCTCTTAAAGTGGAAATTCAGGTTCACCAG - UNI3188 - - UNI16699 - - UNI22192 - 

AAACTGGTTGCCCAAATGAAGCAGGATCCACAG - UNI22192 - - UNI23759 - AATGCTGACTTAAAGAAACAGCTTCATGAACTCCAAGCCA

AAATCACAGCTTTGAGTGAGAAACAG - UNI7400 - - UNI26419 - AAAAGAGTAGTTGAGCAGCTGCGCAAGAACCTGATAGTCAAACAAGAG

CAGCCGGACAAGTTCCAGATACAGCCATTGTCACAGTCTGAAAACAAACTACAAACAGCACAGCAGCAGCCACTACAGCCACTGCAGCAGCAGCAACCGC

AGCAACCGCAGCAGCAGCAGCAGCAGCAGCAGCAGCACGCCCAGCAGTCAGCAGCAGCACCGCCTAGTCTAACTGCATCACAG - UNI26419 - ACT

GTAACTACAGCTTCTATGATTACCACAAAGACACTACCTCTCGTCTTGAAAGCAGCAACTGCGACCATGCCTGCCTCTGTTGTGGGCCAGAGACCTACCA

TTGCTATGGTGACCGCCATCAACAGCCAGAAGGCTGTGCTCAGCACTGATGTGCAGAACACACCAGTCAACCTCCAGACGTCTAGTAAGGTCACTGGGCC

TGGGGCAGAGGCTGTCCAAATTGTGGCAAAAAACACAGTCACTCTG CAGGTTCAAGCAACACCTCCTCAGCCCATCAAAGTACCACAGTTTATCCCTCC

TCCTAGACTCACTCCACGCCCAAACTTCCTTCCACAG GTTCGACCCAAGCCTGTGGCCCAGAATAACATTCCTATCGCTCCAGCGCCTCCTCCCATGCT

TGCAGCTCCTCAGCTTATCCAGAGGCCTGTCATGCTGACCAAGTTTACACCCACAACCCTCCCCACATCCCAGAATTCCATCCACCCTGTCCGTGTTGTC

AATGGACAGACTGCAACCATAGCCAAAACGTTCCCCATGGCCCAGCTCACCAGCATTGTCATAGCTACTCCAGGGACCAGACTCCCTGGACCTCAGACTG

TACAGCTTAGCAAACCAAGCCTGGAGAAACAG TTAAATCCCACCCAGAAGCAGAGGAAAAACAAGCAGA GGTTGGTAACACATGACCATCTAGAAG A

AATCCAAAGCAAGAGGCAGGAAAGAAAGAGAAGAACAACAGCAAACCCGGTGTACAGTGGGGCTGTCTTTGAGCCAGAG CGTAAGAAGAGTGCAGTCAC

TTACCTTAACAGCACAATGCATCCTGGGACGCGGAAGAGAG CCAATGAGGAACACTGGCCAAAG CCTGTGTCTTTGCCCAGCCCCACCTCCACAGAC 

GGTGATATCCATGAGGATTTTTGCAGTGTTTGCAGAAAAAGTGGCCAGTTGCTGATGTGTGACACGTGTTCCCGTGTGTATCATCTGGACTGCTTAGAGC

CGCCCCTGAAAACAATTCCCAAGGGCATGTGGATCTGTCCCAGATGTCAGGACCAG - UNI20910 - ATGCTAAAGAAGGAAGAAGCAATTCCTTGG

CCTGGAACCTTAGCCATTGTTCATTCCTACATCGCCTACAAAGCAG CAAAAGAAGAGGAGAAACAGAAGCTACTTAAGTGGAGTTCAGATTTAAAACAG

GAGCGGGAACAACTGGAGCAGAAGGTCAAAGAGCTCAGCAGTTCTATAAGT AAATGTATGGAGATGAAGAGCAGCATCCTGGCGCGGCAGAAGGAGATG

CGCAGCTCCCTGGACAAGGTGAAGCGGCTCATCCGCCTTGTGCATGGCGTCGACCTCTGCAGACCTGTGGACTCAGAGGCCACGGCGGGGGCCCTCTCCA

ATGGCCCAGACTGCACTCCCCCTGCCAACGCCGCCTCCACACCCGCCCCTTCCCCCTCCTCGCAGAGCTGCACAGCGAACTGTAACCAGGGGGAAGAGAC

TAAATAACAGAGCCCTCGAGGCGGACATGCCACAGTCCTGGTGGCGAGGAGACGCTAGAAGAGCAAAGCCGGATTTCTTCTGGAAAGTACAGAGTTCTTT

TGGTTCTTTGGTTCCAGAGAGAGAGAAGATGCTTGTGCCAGGTGGCACCCGAGTTTGCCAATTGATTCTTGTTATTCTGTGTGTACATGCAAAGACTGGA

CCATGTTACATGAAATAGTGCCAGCTGGAGGTTCTTTGCCAGCACCATGCCAAGTGACATAATATATTACTCTCTCTATTATACACCAGTGTGTGCCTGC

AGCAGCCTCCACAGCCACGGTGGGTTCGTTTTTGTTTTGTTGGGTGGGGAGCAGGGACGGGCGGAGGGAGGAGAGCAGGTTTCAGATCCTTACTGGGAGC

CGTTTGTTTAGGTAGAAAGACAAGTCCAAAGAGTGTGTGGGCTTTCCTGTTCCTAAACTTTTCACTACCATAAAACC
Translation
 - UNI3188 - - UNI14434 - - UNI16699 - - UNI20077 - - UNI31455 - - UNI34655 -  - UNI3188 - - UNI1669

9 - - UNI22192 - MKQDPQ - UNI22192 - - UNI23759 - NADLKKQLHELQAKITALSEKQ - UNI7400 - - UNI26419 - KR

VVEQLRKNLIVKQEQPDKFQIQPLSQSENKLQTAQQQPLQPLQQQQPQQPQQQQQQQQQHAQQSAAAPPSLTASQ - UNI26419 - TVTTASMITTK

TLPLVLKAATATMPASVVGQRPTIAMVTAINSQKAVLSTDVQNTPVNLQTSSKVTGPGAEAVQIVAKNTVTL QVQATPPQPIKVPQFIPPPRLTPRPNF

LPQ VRPKPVAQNNIPIAPAPPPMLAAPQLIQRPVMLTKFTPTTLPTSQNSIHPVRVVNGQTATIAKTFPMAQLTSIVIATPGTRLPGPQTVQLSKPSLE

KQ LNPTQKQRKNKQR RLVTHDHLEE EIQSKRQERKRRTTANPVYSGAVFEPE RKKSAVTYLNSTMHPGTRKRA ANEEHWPK PVSLPSPTSTD G

DIHEDFCSVCRKSGQLLMCDTCSRVYHLDCLEPPLKTIPKGMWICPRCQDQ - UNI20910 - MLKKEEAIPWPGTLAIVHSYIAYKAA AKEEEKQK

LLKWSSDLKQEREQLEQKVKELSSSIS KCMEMKSSILARQKEMRSSLDKVKRLIRLVHGVDLCRPVDSEATAGALSNGPDCTPPANAASTPAPSPSSQS

CTANCNQGEETK
Transcript ENSMUST00000044036
Sequence
TGAGAACAACAACAAAAACTGAGCCCACTACCTCATA - UNI3188 - - UNI14434 - - UNI16699 - - UNI20077 - - UNI31455 

- - UNI34655 - AGCTGCAGCAACAAGAGGAGCTTGTAATTTTAAACGGAGGCTGAAGACACTGTAGAATTAGCAGACATAAGAGAGCGTGGAGAAG

GCAGAGGATGGAGTTGCAGACTCTACAGGAGGCTCTTAAAGTGGAAATTCAGGTTCACCAG - UNI3188 - - UNI16699 - - UNI22192 - 

AAACTGGTTGCCCAAATGAAGCAGGATCCACAG - UNI22192 - - UNI23759 - AATGCTGACTTAAAGAAACAGCTTCATGAACTCCAAGCCA

AAATCACAGCTTTGAGTGAGAAACAG - UNI7400 - - UNI26419 - AAAAGAGTAGTTGAGCAGCTGCGCAAGAACCTGATAGTCAAACAAGAG

CAGCCGGACAAGTTCCAGATACAGCCATTGTCACAGTCTGAAAACAAACTACAAACAGCACAGCAGCAGCCACTACAGCCACTGCAGCAGCAGCAACCGC

AGCAACCGCAGCAGCAGCAGCAGCAGCAGCAGCAGCACGCCCAGCAGTCAGCAGCAGCACCGCCTAGTCTAACTGCATCACAG - UNI26419 - CAG

GTTCAAGCAACACCTCCTCAGCCCATCAAAGTACCACAGTTTATCCCTCCTCCTAGACTCACTCCACGCCCAAACTTCCTTCCACAG GTTCGACCCAAG

CCTGTGGCCCAGAATAACATTCCTATCGCTCCAGCGCCTCCTCCCATGCTTGCAGCTCCTCAGCTTATCCAGAGGCCTGTCATGCTGACCAAGTTTACAC

CCACAACCCTCCCCACATCCCAGAATTCCATCCACCCTGTCCGTGTTGTCAATGGACAGACTGCAACCATAGCCAAAACGTTCCCCATGGCCCAGCTCAC

CAGCATTGTCATAGCTACTCCAGGGACCAGACTCCCTGGACCTCAGACTGTACAGCTTAGCAAACCAAGCCTGGAGAAACAG ACAGTTAAATCCCACCC

AGAAGCAGAGGAAAAACAAGCAGAGAGCCGTACCGTTACCCCACCTGCTGCACCAAAACCAAAACGAGAAGAGAACCCTCAG AAACTTGCCTTCATGGT

GTCTCTAGGGTTGGTAACACATGACCATCTAGAAG AAATCCAAAGCAAGAGGCAGGAAAGAAAGAGAAGAACAACAGCAAACCCGGTGTACAGTGGGGC

TGTCTTTGAGCCAGAG CGTAAGAAGAGTGCAGTCACTTACCTTAACAGCACAATGCATCCTGGGACGCGGAAGAGAG GTCGTCCTCCAAAATACAATG

CGGTGCTGGGGTTTGGAGCCCTTACCCCAACATCCCCCCCATCCAGTCATCCCGACTCCCCTGAAAATGAAAAGACAGAGACCACATTCACTTTCCCTGC

ACCTGTTCAGCCTGTGTCTTTGCCCAGCCCCACCTCCACAGAC GGTGATATCCATGAGGATTTTTGCAGTGTTTGCAGAAAAAGTGGCCAGTTGCTGAT

GTGTGACACGTGTTCCCGTGTGTATCATCTGGACTGCTTAGAGCCGCCCCTGAAAACAATTCCCAAGGGCATGTGGATCTGTCCCAGATGTCAGGACCAG

 - UNI20910 - ATGCTAAAGAAGGAAGAAGCAATTCCTTGGCCTGGAACCTTAGCCATTGTTCATTCCTACATCGCCTACAAAGCAG CAAAAGAAG

AGGAGAAACAGAAGCTACTTAAGTGGAGTTCAGATTTAAAACAGGAGCGGGAACAACTGGAGCAGAAGGTCAAAGAGCTCAGCAGTTCTATAAGT AAAT

GTATGGAGATGAAGAGCAGCATCCTGGCGCGGCAGAAGGAGATGCGCAGCTCCCTGGACAAGGTGAAGCGGCTCATCCGCCTTGTGCATGGCGTCGACCT

CTGCAGACCTGTGGACTCAGAGGCCACGGCGGGGGCCCTCTCCAATGGCCCAGACTGCACTCCCCCTGCCAACGCCGCCTCCACACCCGCCCCTTCCCCC

TCCTCGCAGAGCTGCACAGCGAACTGTAACCAGGGGGAAGAGACTAAATAACAGAGCCCTCGAGGCGGACATGCCACAGTCCTGGTGGCGAGGAGACGCT

AGAAGAGCAAAGCCGGATTTCTTCTGGAAAGTACAGAGTTCTTTTGGTTCTTTGGTTCCAGAGAGAGAGAAGATGCTTGTGCCAGGTGGCACCCGAGTTT

GCCAATTGATTCTTGTTATTCTGTGTGTACATGCAAAGACTGGACCATGTTACATGAAATAGTGCCAGCTGGAGGTTCTTTGCCAGCACCATGCCAAGTG

ACATAATATATTACTCTCTCTATTATACACCAGTGTGTGCCTGCAGCAGCCTCCACAGCCACGGTGGGTTCGTTTTTGTTTTGTTGGGTGGGGAGCAGGG

ACGGGCGGAGGGAGGAGAGCAGGTTTCAGATCCTTACTGGGAGCCGTTTGTTTAGGTAGAAAGACAAGTCCAAAGAGTGTGTGGGCTTTCCTGTTCCTAA

ACTTTTCACTACCATAAAACC
Translation
 - UNI3188 - - UNI14434 - - UNI16699 - - UNI20077 - - UNI31455 - - UNI34655 -  - UNI3188 - - UNI1669

9 - - UNI22192 - MKQDPQ - UNI22192 - - UNI23759 - NADLKKQLHELQAKITALSEKQ - UNI7400 - - UNI26419 - KR

VVEQLRKNLIVKQEQPDKFQIQPLSQSENKLQTAQQQPLQPLQQQQPQQPQQQQQQQQQHAQQSAAAPPSLTASQ - UNI26419 - QVQATPPQPIK

VPQFIPPPRLTPRPNFLPQ VRPKPVAQNNIPIAPAPPPMLAAPQLIQRPVMLTKFTPTTLPTSQNSIHPVRVVNGQTATIAKTFPMAQLTSIVIATPGT

RLPGPQTVQLSKPSLEKQ TVKSHPEAEEKQAESRTVTPPAAPKPKREENPQ KLAFMVSLGLVTHDHLEE EIQSKRQERKRRTTANPVYSGAVFEPE 

RKKSAVTYLNSTMHPGTRKRG GRPPKYNAVLGFGALTPTSPPSSHPDSPENEKTETTFTFPAPVQPVSLPSPTSTD GDIHEDFCSVCRKSGQLLMCDT

CSRVYHLDCLEPPLKTIPKGMWICPRCQDQ - UNI20910 - MLKKEEAIPWPGTLAIVHSYIAYKAA AKEEEKQKLLKWSSDLKQEREQLEQKVKE

LSSSIS KCMEMKSSILARQKEMRSSLDKVKRLIRLVHGVDLCRPVDSEATAGALSNGPDCTPPANAASTPAPSPSSQSCTANCNQGEETK
Transcript ENSMUST00000090589
Sequence
TGAGAACAACAACAAAAACTGAGCCCACTACCTCATA - UNI3188 - - UNI14434 - - UNI16699 - - UNI20077 - - UNI31455 

- - UNI34655 - AGCTGCAGCAACAAGAGGAGCTTGTAATTTTAAACGGAGGCTGAAGACACTGTAGAATTAGCAGACATAAGAGAGCGTGGAGAAG

GCAGAGGATGGAGTTGCAGACTCTACAGGAGGCTCTTAAAGTGGAAATTCAGGTTCACCAG - UNI3188 - - UNI16699 - - UNI22192 - 

AAACTGGTTGCCCAAATGAAGCAGGATCCACAG - UNI22192 - - UNI23759 - AATGCTGACTTAAAGAAACAGCTTCATGAACTCCAAGCCA

AAATCACAGCTTTGAGTGAGAAACAG - UNI7400 - - UNI26419 - AAAAGAGTAGTTGAGCAGCTGCGCAAGAACCTGATAGTCAAACAAGAG

CAGCCGGACAAGTTCCAGATACAGCCATTGTCACAGTCTGAAAACAAACTACAAACAGCACAGCAGCAGCCACTACAGCCACTGCAGCAGCAGCAACCGC

AGCAACCGCAGCAGCAGCAGCAGCAGCAGCAGCAGCACGCCCAGCAGTCAGCAGCAGCACCGCCTAGTCTAACTGCATCACAG - UNI26419 - GTT

CAAGCAACACCTCCTCAGCCCATCAAAGTACCACAGTTTATCCCTCCTCCTAGACTCACTCCACGCCCAAACTTCCTTCCACAG GTTCGACCCAAGCCT

GTGGCCCAGAATAACATTCCTATCGCTCCAGCGCCTCCTCCCATGCTTGCAGCTCCTCAGCTTATCCAGAGGCCTGTCATGCTGACCAAGTTTACACCCA

CAACCCTCCCCACATCCCAGAATTCCATCCACCCTGTCCGTGTTGTCAATGGACAGACTGCAACCATAGCCAAAACGTTCCCCATGGCCCAGCTCACCAG

CATTGTCATAGCTACTCCAGGGACCAGACTCCCTGGACCTCAGACTGTACAGCTTAGCAAACCAAGCCTGGAGAAACAG ACAGTTAAATCCCACCCAGA

AGCAGAGGAAAAACAAGCA - UNI20910 - GGTTTCAGATCCTTACTGGGAGCCGTTTGTTTAGGTAGAAAGACAAGTCCAAAGAGTGTGTGGGCTT

TCCTGTTCCTAAACTTTTCACTACCATAA
Translation
 - UNI3188 - - UNI14434 - - UNI16699 - - UNI20077 - - UNI31455 - - UNI34655 -  - UNI3188 - - UNI1669

9 - - UNI22192 -  - UNI22192 - - UNI23759 -  - UNI7400 - - UNI26419 -  - UNI26419 -  MLAAPQLIQRPVMLT

KFTPTTLPTSQNSIHPVRVVNGQTATIAKTFPMAQLTSIVIATPGTRLPGPQTVQLSKPSLEKQ TVKSHPEAEEKQA - UNI20910 - GFRSLLGA

VCLGRKTSPKSVWAFLFLNFSLP

For any suggestions or comments, please send an email to unitrap@crg.es