Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000058402 (Zfp420)
Chromosomal location
Chr 7: 30645060 - 30700678 (+)
Description
zinc finger protein 420 Gene [Source:MGI (curated);Acc:Zfp420-001]
UniGene
Mm.414360 
MGI
MGI:2444666 
Uniprot/SPTREMBL
O88221 O88261 Q7TMN8 Q8BLA2 Q8BLE1 
Human Ortholog
ENSG00000197050 (ZNF420)
Omim not available
UniTrap UNI15003
Vector Insertion
Chr 7: 30661847 - 30698239
Public Clones D064A04 (ggtc) (ggtc) E025A05 (ggtc) PST14720-NL (escells) PST12241-NL (escells)
IST14870C1 (tigm) IST14981A7 (tigm) IST12737C5 (tigm) IST14185C7 (tigm)
IST12321B2 (tigm) IST14744B8 (tigm) IST14455B10 (tigm) IST10674H11 (tigm)
IST10896C12 (tigm) IST14935F10 (tigm) IST13077F7 (tigm) IST12674E9 (tigm)
IST14606D4 (tigm) IST14118F4 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 69% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI14888
Vector Insertion
Chr 7: 30698260 - 30700114
Public Clones PST3988-NL (escells) PST10800-NR (escells) PST13932-NR (escells) PST3988-NR (escells)
PST11810-NR (escells) PST3117-NR (escells)
Private Clones not available
Severity of mutation (?) Insertion after 71% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000085789
Sequence
CAGCATCAGAGTATTCACACTGGTGAGAAACCCTATGAATGTAAGCAGTGTGGGAAGGCCTTTAGTCGTGATTCCCAGCTAAGTCTTCATCAGAGACTTC

ACACCGGTGAGAAACCCTACACATGCAAGGAATGTGGAAAGGCTTTCACTCAAAGCTCACAACTTATTTTGCACCATAGAATTCATACGGGTGAGAAACC

ATACAAGTGTGAAGCCTGTGGGAAGGCCTTTATTCGAAGCTCACAACTCAGCCGCCATCAAAAGGTCCACACTGGAGAGAAACCCTTTGAATGTAAAGAG

TGTGGGAAGGCCTTCACCCAGAACTCACAACTTACTCTGCACCAGAGACTGCACACTGGTGAGAAGCTCTACGACTGTAAGGAGTGTAGGAAGGTCTTTA

CTCAGCTCTCGCAGCTTATTCTCCATAGAAGAATCCACACTGGCGAGAAACCCTATGAATGCAAT GAGTGTGGGAAGGCTTTTATTCGAGGCTCACTAC

TTATGCAACATCAAAGGATTCACACTGGTGAAAAACCCTATAAATGTGACGAGTGTGGAAAGGCTTTTATCCGTGGTTCCCAACTCACTCAACATCAGAG

GGTTCATACTAACGAAAAGCCTTACGAATGTAAAGAATGTGGAAAGACCTTCAGTCATGGCTCACAACTAACTCAACATCAGAGAATCCATACTGGTGAG

AAGCCCTATCAATGTAAGGAGTGTGGGAAAGCCTTTAATCGCGGGTCACTCCTTACTCGACATCAGAGGATTCACACCGGTGAAAAACCCTACAAATGTA

AAGAATGTGGAAAAAATTTTAGCCGGGGCTCAGAACTTACTCAGCATGAGAGAATCCACACGGGTGAGAAGCCCTATGAGTGTAAGGAATGTGGGAAGTC

CTTTATCCGTGGCTCCCAGCTCACTCAGCATCAAAGAATCCACACAGGTGAAAAACCGTATGAGTGTAAAGAATGCCGAATGGCCTTTACCCAGAGTTCA

CATCTTTCCCAGCATCAGAGACTTCATACCGGTGAGAAACCCTACGTGTGTAGCGAATGTGGGAAGGCCTTTGCACGTGG TTCACAGCTCACTCAACAT

CAGCGAACTCACACTGGAGAGAAACCTTATGAATGTAGGGAATGTGGGAAGGCCTTTGGTCATGGCTCTCAACTTACTCTGCATCAGAGGGTCCACACAG

GTGAGAAGCCCTATGAATGTAAGGAGTGTAGAAAGGCCTTCACTCAGAGTTCACATCTTTCTCGGCACCAACGAGTTCATACTGGCGAGAAACCGTATCA

GTGTAAAGAATGTGAAAAGGCCTTTACAC - UNI15003 - AAAAGAGCATTATTATTATT - UNI14888 - CATCAGAGAATCCACACTGGTAA

AAAACCTTACGAATGTAAGGAATGCGGGAAAGCCTTTAGCTACTGCTCAAATCTCATTGACCATCAGCGAATTCACACTGGTGAGAAGCCTTATGCCTGC

AAAGTATGTGGGAAAGCTTTTACAAAGAGCTCACAACTTTTCCAACACGTGCGAGTTCATACAGGTGAGAAACCTTATGAATGCAAGGAATGCGGCAAAG

CCTTTACGCAGAGCTCGAAGCTTGTTCAGCATCAGAGAATCCACACTGGAGAGAAACCCTATGAGTGCAAGGAATGTGGGAAGGCCTTTAGTAGTGGCTC

AGCCCTTACAAACCATCAGAGAATCCACACTGGGGAGAAACCCTATGAGTGCAAGGAGTGTGGGAAGGCCTTCACTCAGAGCTCACAGCTTAGGCAACAT

CAAAGAATCCATGCTGGCGAGAAACCTTTTGAATGCCTGGAATGTGGAAAGGCCTTCACCCAGAACTCACAGCTTTTTCAGCATCAGAGAGTCCACTCAG

ATGAAAAACCTTATGAATGTAATAAATGTGGGAAGGCCTTT
Translation
QHQSIHTGEKPYECKQCGKAFSRDSQLSLHQRLHTGEKPYTCKECGKAFTQSSQLILHHRIHTGEKPYKCEACGKAFIRSSQLSRHQKVHTGEKPFECKE

CGKAFTQNSQLTLHQRLHTGEKLYDCKECRKVFTQLSQLILHRRIHTGEKPYECN ECGKAFIRGSLLMQHQRIHTGEKPYKCDECGKAFIRGSQLTQHQ

RVHTNEKPYECKECGKTFSHGSQLTQHQRIHTGEKPYQCKECGKAFNRGSLLTRHQRIHTGEKPYKCKECGKNFSRGSELTQHERIHTGEKPYECKECGK

SFIRGSQLTQHQRIHTGEKPYECKECRMAFTQSSHLSQHQRLHTGEKPYVCSECGKAFARG GSQLTQHQRTHTGEKPYECRECGKAFGHGSQLTLHQRV

HTGEKPYECKECRKAFTQSSHLSRHQRVHTGEKPYQCKECEKAFTQ - UNI15003 - QKSIIII - UNI14888 - HQRIHTGKKPYECKECGKA

FSYCSNLIDHQRIHTGEKPYACKVCGKAFTKSSQLFQHVRVHTGEKPYECKECGKAFTQSSKLVQHQRIHTGEKPYECKECGKAFSSGSALTNHQRIHTG

EKPYECKECGKAFTQSSQLRQHQRIHAGEKPFECLECGKAFTQNSQLFQHQRVHSDEKPYECNKCGKAF
Transcript ENSMUST00000057652
Sequence
CTGCCTGTAGTGGAGCCCGGCGCAGGAGGCGGGACCCTGAGCTTCCCTCGGAG AAATCAGGGATGTTTAATGATGTTGCTTTTGACTTCTCTAAG GCT

TGCCCTCTGAACAAGGACTTGTCTTCAAAATAGCACACCAAGGGATCAGAATTGTGTCAGTGGGAAATGAGTGAGACATTCGAAAACTGTATACCTAAGA

CTAATTCTAGAAAATATTTGGAAGTCAGAGTTAGAGAGGGAACGAGAAAATCCGAAGGAATATTACAAGCAAGAGATGGTAACACATGACACAATGTCCG

TTTTCTGCCCAGGCACGCGCCTACCTCAGCATCCACGGGGTTACTCTACAGAGAAGCCCTATAAATGTGAGGAGTGTGGCAAAGCCTTCAGGCGAGCCTC

ACACCTGTCCCAGCATCAGAGTATTCACACTGGTGAGAAACCCTATGAATGTAAGCAGTGTGGGAAGGCCTTTAGTCGTGATTCCCAGCTAAGTCTTCAT

CAGAGACTTCACACCGGTGAGAAACCCTACACATGCAAGGAATGTGGAAAGGCTTTCACTCAAAGCTCACAACTTATTTTGCACCATAGAATTCATACGG

GTGAGAAACCATACAAGTGTGAAGCCTGTGGGAAGGCCTTTATTCGAAGCTCACAACTCAGCCGCCATCAAAAGGTCCACACTGGAGAGAAACCCTTTGA

ATGTAAAGAGTGTGGGAAGGCCTTCACCCAGAACTCACAACTTACTCTGCACCAGAGACTGCACACTGGTGAGAAGCTCTACGACTGTAAGGAGTGTAGG

AAGGTCTTTACTCAGCTCTCGCAGCTTATTCTCCATAGAAGAATCCACACTGGCGAGAAACCCTATGAATGCAATGAGTGTGGGAAAGCTTTCATTTGTG

GCTCACAGCTCTCGCAGCACCGGAAAATCCACAATGGAGAAAAGCCATATGAATGTAAGGAGTGTGGGAAGGCTTTTATTCGAGGCTCACTACTTATGCA

ACATCAAAGGATTCACACTGGTGAAAAACCCTATAAATGTGACGAGTGTGGAAAGGCTTTTATCCGTGGTTCCCAACTCACTCAACATCAGAGGGTTCAT

ACTAACGAAAAGCCTTACGAATGTAAAGAATGTGGAAAGACCTTCAGTCATGGCTCACAACTAACTCAACATCAGAGAATCCATACTGGTGAGAAGCCCT

ATCAATGTAAGGAGTGTGGGAAAGCCTTTAATCGCGGGTCACTCCTTACTCGACATCAGAGGATTCACACCGGTGAAAAACCCTACAAATGTAAAGAATG

TGGAAAAAATTTTAGCCGGGGCTCAGAACTTACTCAGCATGAGAGAATCCACACGGGTGAGAAGCCCTATGAGTGTAAGGAATGTGGGAAGTCCTTTATC

CGTGGCTCCCAGCTCACTCAGCATCAAAGAATCCACACAGGTGAAAAACCGTATGAGTGTAAAGAATGCCGAATGGCCTTTACCCAGAGTTCACATCTTT

CCCAGCATCAGAGACTTCATACCGGTGAGAAACCCTACGTGTGTAGCGAATGTGGGAAGGCCTTTGCACGTGGATTGTTGCTCATACAGCATCAGAGAAT

TCATACTGGCGAGAAGCCGTATCAGTGTAGGGAATGTGGGAAGGCTTTTATCCGCAGTTCACAGCTCACTCAACATCAGCGAACTCACACTGGAGAGAAA

CCTTATGAATGTAGGGAATGTGGGAAGGCCTTTGGTCATGGCTCTCAACTTACTCTGCATCAGAGGGTCCACACAGGTGAGAAGCCCTATGAATGTAAGG

AGTGTAGAAAGGCCTTCACTCAGAGTTCACATCTTTCTCGGCACCAACGAGTTCATACTGGCGAGAAACCGTATCAGTGTAAAGAATGTGAAAAGGCCTT

TACACGTGAGTCTCAACTAATGCGACATCAGAGAATTCATATCCGTGGCAAATCTTTGGACTGTAAGGAATGCCGAATAGACTTTAATCATCATTCGCAA

ATTTTTATATGAGTTAATTTATACTCTGCTAATTAATGTAGCTTTCCCTGGTCATACATTATCAGTGAAGAGTTCTTACAAATGTGAATATGGGACTGTG

AATTCAGCATTTGAGAATTTATGTAGGAGAATAGAAATGCTGATGTAATCCACATAGGAAAACCATGTGTTTACTTGTTTACATTGTATTACATTTTAGC

AAATTAAAGTAGGGAAGTGAATCCGTTGCTGTGATATAGAAGGTCTTTAGCAGAGAAAATTTCTCTATCACATTACACAGGTCCTATCAGTTGGTTTCCT

TTGTTACATTTGTTATGACTAACCTGGCTTTCATGTAATCATTTGTAATATAGATCTAAGATTCTTCTAAAGATCATGTTTTAACATGTAAAAGCACTTG

GATCAGCTCCTTTCATATCATAAATATTAGCTGCTATTTTCATTATTTGCATGAAAGGAGGGAACGGATAAGCATTATCATTAAGAAATCTTTCGTTATT

ATTTGGGAGGCTTTATATACTATCATCAGTGTGAGAAAGCTTTCATTCAGATCTTATTTATTATAGAAGGGAATTTATACTAAAAAGAAGCCTTGGTATC

AGTGGGTTATTGAATACTATGGTTACAGAACTGATTTGTCACAGAGTCCCAAAACTTACATGTTTCACTATCTCTAACTTCAACTCAAGAATATTACTTA

TACATGATAACTAAGCACTCAAGATAAACCTAGGAAATGAAAAAGA
Translation
  MVTHDTMSVFCPGTRLPQHPRGYSTEKPYKCEECGKAFRRASHLSQHQSIHTGEKPYECKQCGKAFSRDSQLSLHQRLHTGEKPYTCKECGKAFTQSS

QLILHHRIHTGEKPYKCEACGKAFIRSSQLSRHQKVHTGEKPFECKECGKAFTQNSQLTLHQRLHTGEKLYDCKECRKVFTQLSQLILHRRIHTGEKPYE

CNECGKAFICGSQLSQHRKIHNGEKPYECKECGKAFIRGSLLMQHQRIHTGEKPYKCDECGKAFIRGSQLTQHQRVHTNEKPYECKECGKTFSHGSQLTQ

HQRIHTGEKPYQCKECGKAFNRGSLLTRHQRIHTGEKPYKCKECGKNFSRGSELTQHERIHTGEKPYECKECGKSFIRGSQLTQHQRIHTGEKPYECKEC

RMAFTQSSHLSQHQRLHTGEKPYVCSECGKAFARGLLLIQHQRIHTGEKPYQCRECGKAFIRSSQLTQHQRTHTGEKPYECRECGKAFGHGSQLTLHQRV

HTGEKPYECKECRKAFTQSSHLSRHQRVHTGEKPYQCKECEKAFTRESQLMRHQRIHIRGKSLDCKECRIDFNHHSQIFI
Transcript ENSMUST00000074876
Sequence
GGCGCAGGAGGCGGGACCCTGAGCTTCCCTCGGAG TACAACACAGAAGAGGAAAAATGGCCATTGTCCATCTAGAAGGGAAGTTTGAG AAATCAGGGA

TGTTTAATGATGTTGCTTTTGACTTCTCTAAG GCTTGCCCTCTGAACAAGGACTTGTCTTCAAAATAGCACACCAAGGGATCAGAATTGTGTCAGTGGG

AAATGAGTGAGACATTCGAAAACTGTATACCTAAGACTAATTCTAGAAAATATTTGGAAGTCAGAGTTAGAGAGGGAACGAGAAAATCCGAAGGAATATT

ACAAGCAAGAGATGGTAACACATGACACAATGTCCGTTTTCTGCCCAGGCACGCGCCTACCTCAGCATCCACGGGGTTACTCTACAGAGAAGCCCTATAA

ATGTGAGGAGTGTGGCAAAGCCTTCAGGCGAGCCTCACACCTGTCCCAGCATCAGAGTATTCACACTGGTGAGAAACCCTATGAATGTAAGCAGTGTGGG

AAGGCCTTTAGTCGTGATTCCCAGCTAAGTCTTCATCAGAGACTTCACACCGGTGAGAAACCCTACACATGCAAGGAATGTGGAAAGGCTTTCACTCAAA

GCTCACAACTTATTTTGCACCATAGAATTCATACGGGTGAGAAACCATACAAGTGTGAAGCCTGTGGGAAGGCCTTTATTCGAAGCTCACAACTCAGCCG

CCATCAAAAGGTCCACACTGGAGAGAAACCCTTTGAATGTAAAGAGTGTGGGAAGGCCTTCACCCAGAACTCACAACTTACTCTGCACCAGAGACTGCAC

ACTGGTGAGAAGCTCTACGACTGTAAGGAGTGTAGGAAGGTCTTTACTCAGCTCTCGCAGCTTATTCTCCATAGAAGAATCCACACTGGCGAGAAACCCT

ATGAATGCAATGAGTGTGGGAAAGCTTTCATTTGTGGCTCACAGCTCTCGCAGCACCGGAAAATCCACAATGGAGAAAAGCCATATGAATGTAAGGAGTG

TGGGAAGGCTTTTATTCGAGGCTCACTACTTATGCAACATCAAAGGATTCACACTGGTGAAAAACCCTATAAATGTGACGAGTGTGGAAAGGCTTTTATC

CGTGGTTCCCAACTCACTCAACATCAGAGGGTTCATACTAACGAAAAGCCTTACGAATGTAAAGAATGTGGAAAGACCTTCAGTCATGGCTCACAACTAA

CTCAACATCAGAGAATCCATACTGGTGAGAAGCCCTATCAATGTAAGGAGTGTGGGAAAGCCTTTAATCGCGGGTCACTCCTTACTCGACATCAGAGGAT

TCACACCGGTGAAAAACCCTACAAATGTAAAGAATGTGGAAAAAATTTTAGCCGGGGCTCAGAACTTACTCAGCATGAGAGAATCCACACGGGTGAGAAG

CCCTATGAGTGTAAGGAATGTGGGAAGTCCTTTATCCGTGGCTCCCAGCTCACTCAGCATCAAAGAATCCACACAGGTGAAAAACCGTATGAGTGTAAAG

AATGCCGAATGGCCTTTACCCAGAGTTCACATCTTTCCCAGCATCAGAGACTTCATACCGGTGAGAAACCCTACGTGTGTAGCGAATGTGGGAAGGCCTT

TGCACGTGGATTGTTGCTCATACAGCATCAGAGAATTCATACTGGCGAGAAGCCGTATCAGTGTAGGGAATGTGGGAAGGCTTTTATCCGCAGTTCACAG

CTCACTCAACATCAGCGAACTCACACTGGAGAGAAACCTTATGAATGTAGGGAATGTGGGAAGGCCTTTGGTCATGGCTCTCAACTTACTCTGCATCAGA

GGGTCCACACAGGTGAGAAGCCCTATGAATGTAAGGAGTGTAGAAAGGCCTTCACTCAGAGTTCACATCTTTCTCGGCACCAACGAGTTCATACTGGCGA

GAAACCGTATCAGTGTAAAGAATGTGAAAAGGCCTTTACACGTGAGTCTCAACTAATGCGACATCAGAGAATTCATATCCGTGGCAAATCTTTGGACTGT

AAGGAATGCCGAATAGACTTTAATCATCATTCGCAAATTTTTATATGAGTTAATTTATACTCTGCTAATTAATGTAGCTTTCCCTGGTCATACATTATCA

GTGAAGAGTTCTTACAAATGTGAATATGGGACTGTGAATTCAGCATTTGAGAATTTATGTAGGAGAATAGAAATGCTGATGTAATCCACATAGGAAAACC

ATGTGTTTACTTGTTTACATTGTATTACATTTTAGCAAATTAAAGTAGGGAAGTGAATCCGTTGCTGTGATATAGAAGGTCTTTAGCAGAGAAAATTTCT

CTATCACATTACACAGGTCCTATCAGTTGGTTTCCTTTGTTACATTTGTTATGACTAACCTGGCTTTCATGTAATCATTTGTAATATAGATCTAAGATTC

TTCTAAAGATCATGTTTTAACATGTAAAAGCACTTGGATCAGCTCCTTTCATATC
Translation
   MVTHDTMSVFCPGTRLPQHPRGYSTEKPYKCEECGKAFRRASHLSQHQSIHTGEKPYECKQCGKAFSRDSQLSLHQRLHTGEKPYTCKECGKAFTQS

SQLILHHRIHTGEKPYKCEACGKAFIRSSQLSRHQKVHTGEKPFECKECGKAFTQNSQLTLHQRLHTGEKLYDCKECRKVFTQLSQLILHRRIHTGEKPY

ECNECGKAFICGSQLSQHRKIHNGEKPYECKECGKAFIRGSLLMQHQRIHTGEKPYKCDECGKAFIRGSQLTQHQRVHTNEKPYECKECGKTFSHGSQLT

QHQRIHTGEKPYQCKECGKAFNRGSLLTRHQRIHTGEKPYKCKECGKNFSRGSELTQHERIHTGEKPYECKECGKSFIRGSQLTQHQRIHTGEKPYECKE

CRMAFTQSSHLSQHQRLHTGEKPYVCSECGKAFARGLLLIQHQRIHTGEKPYQCRECGKAFIRSSQLTQHQRTHTGEKPYECRECGKAFGHGSQLTLHQR

VHTGEKPYECKECRKAFTQSSHLSRHQRVHTGEKPYQCKECEKAFTRESQLMRHQRIHIRGKSLDCKECRIDFNHHSQIFI

For any suggestions or comments, please send an email to unitrap@crg.es