Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000058444 (Map2k5)
Chromosomal location
Chr 9: 63011576 - 63225709 (-)
Description
mitogen-activated protein kinase kinase 5 Gene [Source:MGI Symbol;Acc:MGI:1346345]
RefSeq_dna
NM_011840 
RefSeq_peptide
NP_035970.1 
UniGene
Mm.325746 
MGI
MGI:1346345 
Uniprot/SWISSPROT
Q9WVS7 
Uniprot/SPTREMBL
Q3TM51 
Human Ortholog
ENSG00000137764 (MAP2K5)
Omim not available
UniTrap UNI25786
Vector Insertion
Chr 9: 63205868 - 63219543
Public Clones not available
Private Clones OST166448 (lexicon)
Severity of mutation (?) Insertion after 52% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI36795
Vector Insertion
Chr 9: 63110920 - 63128875
Public Clones IST13760H3 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 65% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI4155
Vector Insertion
Chr 9: 63110002 - 63110920
Public Clones AM0823 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 70% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI8307
Vector Insertion
Chr 9: 63045180 - 63064799
Public Clones RRF345 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 84% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI28500
Vector Insertion
Chr 9: 63011998 - 63042008
Public Clones not available
Private Clones OST29491 (lexicon) OST23817 (lexicon)
Severity of mutation (?) Insertion after 92% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000113943
Sequence
GGTTCCGGAGTAACAGCGGTCTAACGGCCGCCTTCCTCCTCCTCTCGCCGCCACCTCCGCTGCCGGGACGCGGGCCTCAGTCGGACGATCCTGCACGCGC

CGCGCCCTCCGGTTCCGGCTGCGGTCCGGGACCCGCCCCTTGACCCCGCGGCCCTGGGCCCCCCTGCCTGGTTGGAGGGCAGGCGCCACCGGTGCACCTC

CGAAACAGCCCCGACCCAGCCCGCGGCGCCCGGCCACCGTCCCCTTGCCCACCGAGACACTCAGGACGGCAGGACCCTGGCCACTGTACCTGCCTTAAAC

CAGGCCGTTGCTCCGCTGTCTCCTCTTACTCACAAGGACTACAGAATGCTTGTGGGTTCTGTTTTGTCCACTTTTGTAACTCCAGGACCTTCCGCTCTCT

ACTAATTCCTCTTGGCCGGTCCCCCAACAGTGCATCCTCTCCTAGGGACACTCCACACGACCTGGGCCTGGTTTTGGGCCTGCAAGCTCCCTCCTGATCG

CTCCTCTTCACTTCTCCCCATCTTCTTGCTCCCTATTTATCGCCTGCCTTCTGTCTATCGTTCCCCTTGTCACTTCTTGGGGCTCCTCCTAAGTAGGGGC

AGGTCGGTACCCCTCGCCCCAGGATGTGAGACCCTTTAACCTGTAATGCTGTGGCTGGCCCTTGGCCCCTTCTGTGCCATGGAGAACCAGGTGCTGGTGA

TTCGGATCAAGATTCCAAATAGTGGCGCGGTGGACTGGACCGTGCACTCCGGGCCGCAGTTACTCTTCAGGGATGTTCTG GATGTGATAGGCCAGGTTC

TGCCTGAAGCGACGACGACAGCGTTTGAAT - UNI25786 - ATGAAGATGAAGATGGTGATAGGATTACAGTAAGAAGCGATGAAGAGATGAAGGCA

ATGCTGTCCTAC TATTATTCCACAGTAATGGAACAGCAAGTAAATGGCCAGCTAATAGAGCCGCTGCAGATATTTCCAAGAG GTTACCGCAGAGGCAG

TCGTCTGAGAGAATACTGA
Translation
MLWLALGPFCAMENQVLVIRIKIPNSGAVDWTVHSGPQLLFRDVL DVIGQVLPEATTTAFEY - UNI25786 - YEDEDGDRITVRSDEEMKAMLSY

 YYSTVMEQQVNGQLIEPLQIFPRG GYRRGSRLREY
Transcript ENSMUST00000113944
Sequence
GGTTCCGGAGTAACAGCGGTCTAACGGCCGCCTTCCTCCTCCTCTCGCCGCCACCTCCGCTGCCGGGACGCGGGCCTCAGTCGGACGATCCTGCACGCGC

CGCGCCCTCCGGTTCCGGCTGCGGTCCGGGACCCGCCCCTTGACCCCGCGGCCCTGGGCCCCCCTGCCTGGTTGGAGGGCAGGCGCCACCGGTGCACCTC

CGAAACAGCCCCGACCCAGCCCGCGGCGCCCGGCCACCGTCCCCTTGCCCACCGAGACACTCAGGACGGCAGGACCCTGGCCACTGTACCTGCCTTAAAC

CAGGCCGTTGCTCCGCTGTCTCCTCTTACTCACAAGGACTACAGAATGCTTGTGGGTTCTGTTTTGTCCACTTTTGTAACTCCAGGACCTTCCGCTCTCT

ACTAATTCCTCTTGGCCGGTCCCCCAACAGTGCATCCTCTCCTAGGGACACTCCACACGACCTGGGCCTGGTTTTGGGCCTGCAAGCTCCCTCCTGATCG

CTCCTCTTCACTTCTCCCCATCTTCTTGCTCCCTATTTATCGCCTGCCTTCTGTCTATCGTTCCCCTTGTCACTTCTTGGGGCTCCTCCTAAGTAGGGGC

AGGTCGGTACCCCTCGCCCCAGGATGTGAGACCCTTTAACCTGTAATGCTGTGGCTGGCCCTTGGCCCCTTCTGTGCCATGGAGAACCAGGTGCTGGTGA

TTCGGATCAAGATTCCAAATAGTGGCGCGGTGGACTGGACCGTGCACTCCGGGCCGCAGTTACTCTTCAGGGATGTTCTG GATGTGATAGGCCAGGTTC

TGCCTGAAGCGACGACGACAGCGTTTGAAT - UNI25786 - ATGAAGATGAAGATGGTGATAGGATTACAGTAAGAAGCGATGAAGAGATGAAGGCA

ATGCTGTCCTAC TATTATTCCACAGTAATGGAACAGCAAGTAAATGGCCAGCTAATAGAGCCGCTGCAGATATTTCCAAGAG CCTGCAAGCCTCCTGG

GGAACGGAACATACATGGCCTGAAG GTGAATACACGGGCTGGGCCATCTCAACACACCAGCCCTGTGGTCTCAGATTCGCTTCCAAGCAATAG CTTGA

AGAAGTCCTCAGCTGAACTGAGAAAGATACTGGCCAACGGCCAG ATGAATGAACAAGACATACGGTATCGAGACACCCTTGGTCATGGCAACGGAGGCA

CAGTCTACAA ATTGCTGCACATTTAA
Translation
MLWLALGPFCAMENQVLVIRIKIPNSGAVDWTVHSGPQLLFRDVL DVIGQVLPEATTTAFEY - UNI25786 - YEDEDGDRITVRSDEEMKAMLSY

 YYSTVMEQQVNGQLIEPLQIFPRA ACKPPGERNIHGLK VNTRAGPSQHTSPVVSDSLPSNS SLKKSSAELRKILANGQ MNEQDIRYRDTLGHGNG

GTVYK KLLHI
Transcript ENSMUST00000113945
Sequence
GGTTCCGGAGTAACAGCGGTCTAACGGCCGCCTTCCTCCTCCTCTCGCCGCCACCTCCGCTGCCGGGACGCGGGCCTCAGTCGGACGATCCTGCACGCGC

CGCGCCCTCCGGTTCCGGCTGCGGTCCGGGACCCGCCCCTTGACCCCGCGGCCCTGGGCCCCCCTGCCTGGTTGGAGGGCAGGCGCCACCGGTGCACCTC

CGAAACAGCCCCGACCCAGCCCGCGGCGCCCGGCCACCGTCCCCTTGCCCACCGAGACACTCAGGACGGCAGGACCCTGGCCACTGTACCTGCCTTAAAC

CAGGCCGTTGCTCCGCTGTCTCCTCTTACTCACAAGGACTACAGAATGCTTGTGGGTTCTGTTTTGTCCACTTTTGTAACTCCAGGACCTTCCGCTCTCT

ACTAATTCCTCTTGGCCGGTCCCCCAACAGTGCATCCTCTCCTAGGGACACTCCACACGACCTGGGCCTGGTTTTGGGCCTGCAAGCTCCCTCCTGATCG

CTCCTCTTCACTTCTCCCCATCTTCTTGCTCCCTATTTATCGCCTGCCTTCTGTCTATCGTTCCCCTTGTCACTTCTTGGGGCTCCTCCTAAGTAGGGGC

AGGTCGGTACCCCTCGCCCCAGGATGTGAGACCCTTTAACCTGTAATGCTGTGGCTGGCCCTTGGCCCCTTCTGTGCCATGGAGAACCAGGTGCTGGTGA

TTCGGATCAAGATTCCAAATAGTGGCGCGGTGGACTGGACCGTGCACTCCGGGCCGCAGTTACTCTTCAGGGATGTTCTG GATGTGATAGGCCAGGTTC

TGCCTGAAGCGACGACGACAGCGTTTGAAT - UNI25786 - ATGAAGATGAAGATGGTGATAGGATTACAGTAAGAAGCGATGAAGAGATGAAGGCA

ATGCTGTCCTAC TATTATTCCACAGTAATGGAACAGCAAGTAAATGGCCAGCTAATAGAGCCGCTGCAGATATTTCCAAGAG CCTGCAAGCCTCCTGG

GGAACGGAACATACATGGCCTGAAG GTGAATACACGGGCTGGGCCATCTCAACACACCAGCCCTGTGGTCTCAGATTCGCTTCCAAGCAATAG CTTGA

AGAAGTCCTCAGCTGAACTGAGAAAGATACTGGCCAACGGCCAG ATGAATGAACAAGACATACGGTATCGAGACACCCTTGGTCATGGCAACGGAGGCA

CAGTCTACAA AGCACATCATGTCCCAAGTGGGAAAATTTTAGCTGTAAAG GTTATTCTGTTAGACATTACACTGGAGCTTCAGAAGCAGATCATGTCT

GAGCTGGAAATCCTTTATAAG TGTGACTCATCGTATATCATAGGATTTTACGGGGCATTTTTCGTAGAAAACAGGATTTCAATTTGTACAGAATTCATG

GATG GGGGGTCTTTGGATGTATATAGGAAAATTCCAGAGCACGTCCTTGGAAGAATTGCAGTTGCA - UNI36795 - GTTGTTAAAGGCCTTACCT

ATCTGTGGAGTTTAAAGATTTTACACAGAG - UNI36795 - ATGTGAAGCCCTCCAACATGCTTGTAAACACAGGCGGACAGGTCAAGCTGTGTGAC

TTTGGCGTGAGCACACAG - UNI4155 - - UNI36795 - CTGGTGAATTCTATAGCCAAGACGTATGTTGGAACAAATGCTTACATGGCA CCAG

AAAGAATTTCAGGAGAGCAGTATGGGATCCATTCTGACGTGTGGAGCTTAGGAATCTCTTTCATGGAG CTTGCTCTTGGGAGGTTTCCATATCCTCAG 

CCTCTCCAGCTTCTGCAGTGCATTGTTGATGAG - UNI8307 - GATTCGCCGGTCCTTCCGCTTGGAGAGTTCTCGGAGCCGTTTGTACATTTCATC

ACTCAGTG CATGAGGAAGCAGCCCAAGGAGAGACCGGCGCCTGAGGAGCTGATG - UNI28500 - GGTCACCCATTCATCGTGCAGTTCAATGATG

GAAACTCCACTGTGGTGTCCATGTGGGTGTGCCGAGCTCTAGAGGAGAGGCGGAGCCAGCAGGGACCCCCGTGAGACCTCAGCAGGACACTGACCACTGA

GGACCAGTCATCATGACACAGCAAGCCGTGACCCCTCTGTCTGCTGTACTGGCCCAGCCTCCTGCTCGCACCTCCTGCCCTACCTAGGAAGCCCTCCAGA

GGGCCAGCCTCTGCTGAGCGGGGGAAGTGGGCACTGACTACAGCAGGTGGAGATGGTGCAGGGCGGGGTGATGAGGTTATAAAACTATGGAACCTCCTCT

GGCCCCACCCCCTTATCTTTCCCTACTGTTCATTGTAAAGGGTCAGGCCCTATCAGCAGCACTGATGGGAATAAAAGTATTATTGCTTTGG
Translation
MLWLALGPFCAMENQVLVIRIKIPNSGAVDWTVHSGPQLLFRDVL DVIGQVLPEATTTAFEY - UNI25786 - YEDEDGDRITVRSDEEMKAMLSY

 YYSTVMEQQVNGQLIEPLQIFPRA ACKPPGERNIHGLK VNTRAGPSQHTSPVVSDSLPSNS SLKKSSAELRKILANGQ MNEQDIRYRDTLGHGNG

GTVYK KAHHVPSGKILAVK VILLDITLELQKQIMSELEILYK CDSSYIIGFYGAFFVENRISICTEFMDG GGSLDVYRKIPEHVLGRIAVA - UN

I36795 - VVKGLTYLWSLKILHRD - UNI36795 - DVKPSNMLVNTGGQVKLCDFGVSTQ - UNI4155 - - UNI36795 - LVNSIAKTY

VGTNAYMA PERISGEQYGIHSDVWSLGISFME LALGRFPYPQ PLQLLQCIVDE - UNI8307 - DSPVLPLGEFSEPFVHFITQC CMRKQPKER

PAPEELM - UNI28500 - GHPFIVQFNDGNSTVVSMWVCRALEERRSQQGPP
Transcript ENSMUST00000034920
Sequence
GGTTCCGGAGTAACAGCGGTCTAACGGCCGCCTTCCTCCTCCTCTCGCCGCCACCTCCGCTGCCGGGACGCGGGCCTCAGTCGGACGATCCTGCACGCGC

CGCGCCCTCCGGTTCCGGCTGCGGTCCGGGACCCGCCCCTTGACCCCGCGGCCCTGGGCCCCCCTGCCTGGTTGGAGGGCAGGCGCCACCGGTGCACCTC

CGAAACAGCCCCGACCCAGCCCGCGGCGCCCGGCCACCGTCCCCTTGCCCACCGAGACACTCAGGACGGCAGGACCCTGGCCACTGTACCTGCCTTAAAC

CAGGCCGTTGCTCCGCTGTCTCCTCTTACTCACAAGGACTACAGAATGCTTGTGGGTTCTGTTTTGTCCACTTTTGTAACTCCAGGACCTTCCGCTCTCT

ACTAATTCCTCTTGGCCGGTCCCCCAACAGTGCATCCTCTCCTAGGGACACTCCACACGACCTGGGCCTGGTTTTGGGCCTGCAAGCTCCCTCCTGATCG

CTCCTCTTCACTTCTCCCCATCTTCTTGCTCCCTATTTATCGCCTGCCTTCTGTCTATCGTTCCCCTTGTCACTTCTTGGGGCTCCTCCTAAGTAGGGGC

AGGTCGGTACCCCTCGCCCCAGGATGTGAGACCCTTTAACCTGTAATGCTGTGGCTGGCCCTTGGCCCCTTCTGTGCCATGGAGAACCAGGTGCTGGTGA

TTCGGATCAAGATTCCAAATAGTGGCGCGGTGGACTGGACCGTGCACTCCGGGCCGCAGTTACTCTTCAGGGATGTTCTG GATGTGATAGGCCAGGTTC

TGCCTGAAGCGACGACGACAGCGTTTGAAT - UNI25786 - ATGAAGATGAAGATGGTGATAGGATTACAGTAAGAAGCGATGAAGAGATGAAGGCA

ATGCTGTCCTAC TATTATTCCACAGTAATGGAACAGCAAGTAAATGGCCAGCTAATAGAGCCGCTGCAGATATTTCCAAGAG CCTGCAAGCCTCCTGG

GGAACGGAACATACATGGCCTGAAG GTGAATACACGGGCTGGGCCATCTCAACACACCAGCCCTGTGGTCTCAGATTCGCTTCCAAGCAATAG CTTGA

AGAAGTCCTCAGCTGAACTGAGAAAGATACTGGCCAACGGCCAG ATGAATGAACAAGACATACGGTATCGAGACACCCTTGGTCATGGCAACGGAGGCA

CAGTCTACAA AGCACATCATGTCCCAAGTGGGAAAATTTTAGCTGTAAAG GTTATTCTGTTAGACATTACACTGGAGCTTCAGAAGCAGATCATGTCT

GAGCTGGAAATCCTTTATAAG TGTGACTCATCGTATATCATAGGATTTTACGGGGCATTTTTCGTAGAAAACAGGATTTCAATTTGTACAGAATTCATG

GATG GGGGGTCTTTGGATGTATATAGGAAAATTCCAGAGCACGTCCTTGGAAGAATTGCAGTTGCA - UNI36795 - GTTGTTAAAGGCCTTACCT

ATCTGTGGAGTTTAAAGATTTTACACAGAG - UNI36795 - ATGTGAAGCCCTCCAACATGCTTGTAAACACAGGCGGACAGGTCAAGCTGTGTGAC

TTTGGCGTGAGCACACAG - UNI4155 - - UNI36795 - CTGGTGAATTCTATAGCCAAGACGTATGTTGGAACAAATGCTTACATGGCA CCAG

AAAGAATTTCAGGAGAGCAGTATGGGATCCATTCTGACGTGTGGAGCTTAGGAATCTCTTTCATGGAG CTTGCTCTTGGGAGGTTTCCATATCCTCAG 

ATTCAGAAAAACCAGGGATCTTTAATG CCTCTCCAGCTTCTGCAGTGCATTGTTGATGAG - UNI8307 - GATTCGCCGGTCCTTCCGCTTGGAGA

GTTCTCGGAGCCGTTTGTACATTTCATCACTCAGTG CATGAGGAAGCAGCCCAAGGAGAGACCGGCGCCTGAGGAGCTGATG - UNI28500 - GGT

CACCCATTCATCGTGCAGTTCAATGATGGAAACTCCACTGTGGTGTCCATGTGGGTGTGCCGAGCTCTAGAGGAGAGGCGGAGCCAGCAGGGACCCCCGT

GAGACCTCAGCAGGACACTGACCACTGAGGACCAGTCATCATGACACAGCAAGCCGTGACCCCTCTGTCTGCTGTACTGGCCCAGCCTCCTGCTCGCACC

TCCTGCCCTACCTAGGAAGCCCTCCAGAGGGCCAGCCTCTGCTGAGCGGGGGAAGTGGGCACTGACTACAGCAGGTGGAGATGGTGCAGGGCGGGGTGAT

GAGGTTATAAAACTATGGAACCTCCTCTGGCCCCACCCCCTTATCTTTCCCTACTGTTCATTGTAAAGGGTCAGGCCCTATCAGCAGCACTGATGGGAAT

AAAAGTATTATTGCTTTGG
Translation
MLWLALGPFCAMENQVLVIRIKIPNSGAVDWTVHSGPQLLFRDVL DVIGQVLPEATTTAFEY - UNI25786 - YEDEDGDRITVRSDEEMKAMLSY

 YYSTVMEQQVNGQLIEPLQIFPRA ACKPPGERNIHGLK VNTRAGPSQHTSPVVSDSLPSNS SLKKSSAELRKILANGQ MNEQDIRYRDTLGHGNG

GTVYK KAHHVPSGKILAVK VILLDITLELQKQIMSELEILYK CDSSYIIGFYGAFFVENRISICTEFMDG GGSLDVYRKIPEHVLGRIAVA - UN

I36795 - VVKGLTYLWSLKILHRD - UNI36795 - DVKPSNMLVNTGGQVKLCDFGVSTQ - UNI4155 - - UNI36795 - LVNSIAKTY

VGTNAYMA PERISGEQYGIHSDVWSLGISFME LALGRFPYPQ IQKNQGSLM PLQLLQCIVDE - UNI8307 - DSPVLPLGEFSEPFVHFITQC

 CMRKQPKERPAPEELM - UNI28500 - GHPFIVQFNDGNSTVVSMWVCRALEERRSQQGPP

For any suggestions or comments, please send an email to unitrap@crg.es