Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000058503 (5830415L20Rik)
Chromosomal location
Chr 5: 3543833 - 3570548 (+)
Description
RIKEN cDNA 5830415L20 gene Gene [Source:MGI Symbol;Acc:MGI:1915402]
RefSeq_dna
NM_001042501 
RefSeq_peptide
NP_001035966.1 
UniGene
Mm.240265 
MGI
MGI:1915402 
Uniprot/SWISSPROT
Q9CVI2 
Uniprot/SPTREMBL
B2RVR0 
Human Ortholog
ENSG00000197918 (AC021171.6)
Omim not available
UniTrap UNI4919
Vector Insertion
Chr 5: 3543948 - 3554315
Public Clones AP0177 (sanger) RHA271 (baygenomics) IST11272E7 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI18429
Vector Insertion
Chr 5: 3554336 - 3554637
Public Clones not available
Private Clones OST423505 (lexicon)
Severity of mutation (?) Insertion after 5% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI4380
Vector Insertion
Chr 5: 3557823 - 3558472
Public Clones AE0719 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 53% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI4397
Vector Insertion
Chr 5: 3559160 - 3559605
Public Clones AE0365 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 98% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI30397
Vector Insertion
Chr 5: 3565751 - 3568986
Public Clones CMHD-GT_401C6-3 (cmhd)
Private Clones not available
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000115527
Sequence
AGTAGGAGAAGTAACAGTAA - UNI18429 - GGCCTACATGAATCCAATAGCAATGGCTCGATCAAGGGGTCCAATCCAGTCTTCAGGACCAACAAT

CCAGGATTATCTGAATCGACCAAGGCCTACCTG GGAGGAAGTCAAGGAACAGCTGGAAAAGAAAAAGAAGGGCTCCAAGGCTTTGGCTGAGTTTGAAGA

AAAAATGAATGAG - UNI4380 - AATTGGAAGAAAGAACTAGAAAAACATAGAGAAAAATTATTAAGTGGAAATGAGAGCTCATCCAAAAAAAGACA

G AAAAAGAAAAAAGAAAAGAAGAAATCTGGTAGG TATTCATCTTCTTCTTCATCGAGCTCTGATTCTTCCAGCAGTTCTTCAGATTCCGAAGATGAG 

- UNI4397 - GATAAAAAACAAACAAAAAGAAGGAAGAAAAAGAAGAGCCGTTGCCATAAGTCTCCTGAGAGCTCGGGGTCGGATTCGGCTTCAGACA

GCAAG GATGGTTCAAAAAAGAAAAAGAAGTCCAAGGATGTAACTGAAAGAGAAAAG GACACTAAAGGTCTCAGCAAAAAGAGAAAGATGTACGAAGAT

AAACCGTTGTCATCTGAGTCGCTGTCAGAGTCAGACTGTGGAGAG GTGCAAGCAAAAAGGAAGAAAAGCGGTGAAGAGCGTGAGAGAACAACA - UNI

30397 - GACAAAGCCAAAAAGAGAAGGAAGCATAAGAAGCACAGCAAGAAGAAGAAAAAGAAGGCCGCCAGCTCCAGCTCAGACTCGCCGTAGCGTCC

ATGAAGACCAGGACCCTTACCCAGTGCAGTGTCAAAGGAGCTCAACTGTGAAGATTGCGACACACTTAGTAACGTGCATGAATTCCCTTGTTCTTAGACT

TGTCCTGGACTAGTCAGTAGCCACTTGGATTCTGCTGTGTGAAGGGCCATGATTGTTGCCTGCTGCTTCAACACCTTTTCCTCTTCCAGTGCTTGGTGAC

TCTGGGAGATAGTACTTTGCAGTCATACTAGTGATTAAGATATCTGGAATAAAGCTAATATTTTTTACTAGAAGTACTTAAGAATAAATCAACAGAAACT

GAATCTGGATTCATCTTTTAAGATGTAACCAGAAAAAATGAGATGACTCTAGTAAAAATTTTCAAAGTAGGGATTACATTAATATTTCAGAATCCTTACT

CTGTAGATAAGTATATTTTAATTTTCCCCATGTATACTTTGATTTACTTGGGGAAGGAGCTTTTAAAGGGGGTGGTTTGCTATCTCTTTAGCTACCAGAA

CAGTGTGCCTTTGATCTCACACATCCTACTTTTATGGACACAGTAGCCATGCTTCCTGGGAGGACAGAGCTGGGCACCGTCATTCCTGCCCGACTGAGGT

TATGACATCCTTAGACTTTGTTGTATGCTGCTTCGAATGAACCAGAGATACCCGGCCCTTTGCAGCATGAGAAAGCCCCCAAAGCTCTGGAATTTACCTC

CACATCAATAATAAGTGAATGTTTTCAGGGTT
Translation
SRRSNSK - UNI18429 - KAYMNPIAMARSRGPIQSSGPTIQDYLNRPRPTW WEEVKEQLEKKKKGSKALAEFEEKMNE - UNI4380 - NWKK

ELEKHREKLLSGNESSSKKRQ KKKKEKKKSGR YSSSSSSSSDSSSSSSDSEDE - UNI4397 - DKK    - UNI30397 - 
Transcript ENSMUST00000095034
Sequence
ATAGAGGTGGTAAGAGGACTCGCGGCGGGCCGCTTCGGCTTCTTCTCGGGCCTGCTCCCTCGGCGGCTTCCCGCGCCTTCAGCCGGCCACCATGGGGAAA

CGGGATAATCGCGTG - UNI4919 - - UNI18429 - GCCTACATGAATCCAATAGCAATGGCTCGATCAAGGGGTCCAATCCAGTCTTCAGGACC

AACAATCCAGGATTATCTGAATCGACCAAGGCCTACCTG GGAGGAAGTCAAGGAACAGCTGGAAAAGAAAAAGAAGGGCTCCAAGGCTTTGGCTGAGTT

TGAAGAAAAAATGAATGAG - UNI4380 - AATTGGAAGAAAGAACTAGAAAAACATAGAGAAAAATTATTAAGTGGAAATGAGAGCTCATCCAAAAA

AAGACAG AAAAAGAAAAAAGAAAAGAAGAAATCTGGTAGG TATTCATCTTCTTCTTCATCGAGCTCTGATTCTTCCAGCAGTTCTTCAGATTCCGAAG

ATGAG - UNI4397 - GATAAAAAACAAACAAAAAGAAGGAAGAAAAAGAAGAGCCGTTGCCATAAGTCTCCTGAGAGCTCGGGGTCGGATTCGGCTT

CAGACAGCAAG GATGGTTCAAAAAAGAAAAAGAAGTCCAAGGATGTAACTGAAAGAGAAAAG GACACTAAAGGTCTCAGCAAAAAGAGAAAGATGTAC

GAAGATAAACCGTTGTCATCTGAGTCGCTGTCAGAGTCAGACTGTGGAGAG GTGCAAGCAAAAAGGAAGAAAAGCGGTGAAGAGCGTGAGAGAACAACA

 - UNI30397 - GACAAAGCCAAAAAGAGAAGGAAGCATAAGAAGCACAGCAAGAAGAAGAAAAAGAAGGCCGCCAGCTCCAGCTCAGACTCGCCGTA

GCGTCCATGAAGACCAGGACCCTTACCCAGTGCAGTGTCAAAGGAGCTCAACTGTGAAGATTGCGACACACTTAGTAACGTGCATGAATTCCCTTGTTCT

TAGACTTGTCCTGGACTAGTCAGTAGCCACTTGGATTCTGCTGTGTGAAGGGCCATGATTGTTGCCTGCTGCTTCAACACCTTTTCCTCTTCCAGTGCTT

GGTGACTCTGGGAGATAGTACTTTGCAGTCATACTAGTGATTAAGATATCTGGAATAAAGCTAATATTTTTTACTAGAAGTACTTAAGAATAAATCAACA

GAAACTGAATCTGGATTCATCTTTTAAGATGTAACCAGAAAAAATGAGATGACTCTAGTAAAAATTTTCAAAGTAGGGATTACATTAATATTTCAGAATC

CTTACTCTGTAGATAAGTATATTTTAATTTTCCCCATGTATACTTTGATTTACTTGGGGAAGGAGCTTTTAAAGGGGGTGGTTTGCTATCTCTTTAGCTA

CCAGAACAGTGTGCCTTTGATCTCACACATCCTACTTTTATGGACACAGTAGCCATGCTTCCTGGGAGGACAGAGCTGGGCACCGTCATTCCTGCCCGAC

TGAGGTTATGACATCCTTAGACTTTGTTGTATGCTGCTTCGAATGAACCAGAGATACCCGGCCCTTTGCAGCATGAGAAAGCCCCCAAAGCTCTGGAATT

TACCTCCACATCAATAATAAGTGAATGTTTTCAGGGTTACATTGTGTTGTGTCATTTGAATTCAATTTGACTACGCTTGGGCTTTGGAGAGGGACTGTTG

AGTAGACGCAGGTACTTTCTGAGCTTGATAGCTGACAATTCTAAAGCGCATGTGTTACACAAGTTTTAACCAGTCAGGAGATTTTTACATAGCCAGTGAT

AGATACTTTATGTTTTGTATAAATTTTGTTTAGGCTGCAATGTTTAGCTTTTAACTAACTCTTGCTGTCTTAAGTTCATAACTATGTTTAATGGCACACT

TACAAGATATTTAGCATGTAAAAAGCAAGACTTTTGTTTTTTTGTTTTTAACGGCTTCATATTGAAGCTGAGACTTTACCACAAACAAGTTGAGTGGCAG

GCCTGGTATGCTGTATCTTGTTACATAAAGCTCTTGCCAGAATCTTAGTAAACACATGTTTTAAAAGTTTGTTGTCTTTGTGTATCAGTAACAGATGATG

ACACTGTTGATGATGATGATGTTAACTTGTGTGAGAGCTACAGTGCTGCTCTTCTGTGCTGTGTCCTCTAAGACTTTGTGCTTCGAAGCTGCTGAGTGAT

TTGGAAGGGTCAAAGGACTTGATAACTCACTTTCATTTTACACTTTATATAATCTGATTGTGAAATATAACAATGGACAGTTTAGCCAGTCTCAGAAGTT

ATGCTAATTATAGTGGAATATGCACAGAACATTTTGGCATGAAAAGAGGCTGAATAAATAGCTATTTTACTTAAAA
Translation
MGKRDNRV - UNI4919 - - UNI18429 - AYMNPIAMARSRGPIQSSGPTIQDYLNRPRPTW WEEVKEQLEKKKKGSKALAEFEEKMNE - UN

I4380 - NWKKELEKHREKLLSGNESSSKKRQ KKKKEKKKSGR YSSSSSSSSDSSSSSSDSEDE - UNI4397 - DKKQTKRRKKKKSRCHKSPE

SSGSDSASDSK DGSKKKKKSKDVTEREK DTKGLSKKRKMYEDKPLSSESLSESDCGE VQAKRKKSGEERERTT - UNI30397 - DKAKKRRKHK

KHSKKKKKKAASSSSDSP

For any suggestions or comments, please send an email to unitrap@crg.es