Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000058550 (Dppa4)
Chromosomal location
Chr 16: 48283848 - 48294405 (+)
Description
developmental pluripotency associated 4 Gene [Source:MGI Symbol;Acc:MGI:2157525]
RefSeq_dna
NM_001018002 NM_028610 
RefSeq_peptide
NP_001018002.1 NP_082886.2 
UniGene
Mm.35597 
MGI
MGI:2157525 
Uniprot/SWISSPROT
Q8CCG4 
Uniprot/SPTREMBL
Q9CWG7 
Human Ortholog
ENSG00000121570 (DPPA4)
Omim not available
UniTrap UNI16649
Vector Insertion
Chr 16: 48283955 - 48287990
Public Clones (sanger) D148B02 (ggtc) IST12926A8 (tigm)
Private Clones OST456351 (lexicon) OST367616 (lexicon) OST338241 (lexicon) OST316472 (lexicon)
OST315823 (lexicon) OST303333 (lexicon) OST251998 (lexicon) OST218608 (lexicon)
OST170342 (lexicon) OST151881 (lexicon) OST151850 (lexicon) OST145335 (lexicon)
OST141468 (lexicon) OST138476 (lexicon) OST64826 (lexicon)
Severity of mutation (?) Insertion after 3% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI14977
Vector Insertion
Chr 16: 48288109 - 48289151
Public Clones PST10297-NR (escells) PST10673-NR (escells) PST3222-NR (escells) PST12439-NR (escells)
PST7901-NL (escells) PST11653-NR (escells) PST2567-NL (escells)
Private Clones not available
Severity of mutation (?) Insertion after 16% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI25370
Vector Insertion
Chr 16: 48291126 - 48291428
Public Clones not available
Private Clones OST186460 (lexicon)
Severity of mutation (?) Insertion after 40% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI14914
Vector Insertion
Chr 16: 48291429 - 48293023
Public Clones PST1000-3 (escells) PST8102-NR (escells) PST1000-2 (escells) PST4854-NL (escells)
PST1000-1 (escells)
Private Clones not available
Severity of mutation (?) Insertion after 74% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI15171
Vector Insertion
Chr 16: 48293094 - 48293094
Public Clones PST11776-NR (escells) PST10485-NR (escells) PST6307-NR (escells)
Private Clones not available
Severity of mutation (?) Insertion after 82% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000114539
Sequence
ATGGAGACTGCTGGAGACAAGAAG - UNI16649 - TGGAGCGCAGAAGAGCCGAAGGAAGAAGTGGAATTGCAGATGTCTAGTCAACCAAGCACGGC

TCCTGCAAAGGCTAAAGCAACGGGGAAAAAACAAAAGAAGTCGGAGACAGATAATG - UNI14977 - GTTGTAAACCAAAGGAGGGAAAACCACAAG

ACACTGAGACGCCAGGACAGACTCGTAGGAAGGTACCAATTCCTCCTATTCCAGAGTATCTGCCCCCAGTGAACCTGATTCACCGAGATGTTTTGCGGGC

ATGGTGCCAGAAGAAACGAGTGAGCAGCAAAGGCCAG AAATTAGATGCTTATAAACGACTCCTTGCAAGGGCTTTCCCAGAACAAATG - UNI25370

 - CTGGAGTTGAGGAACGTCCCTGACTCAGCCAAAGACGCCAGGTTGAAGACAGCTCACAAAAAAATGAAGACTGAACCGGGGGAGGAGTCTGAGGTGA

CAGTTCCTCTGGAAATGGTCCCTGTGCCAGAGGAGCAGATACCTGCCCTCATTGACCCTCCTATGCTCTATGAGGAAGTCAGCACCACCGTAGTGACTAC

ACCTGCCACTGAGGCCGTGTTAGCATCTTGGGCCAGAATTGCATCCAATGCTAAGAAGTACGAGGCAGTGCCAGCCGATGCTTCGTCCTCATCAGAAGTC

AAAGG - UNI14914 - GGGAAATGTGGTGTGTGGTTCATGGGACCAGCCTTCCTGGGAACTCGCGTGGTTGGGTTCGGCTGCAGTT - UNI15171

 - CACGCTGGACAAGCCTGGGTACCCGATAAGAAAGGAAAAGCCATTGCCCTCTTCCTGCTTCCGGCCTGCACATTTCCACCCCCACACCTGGAGGACA

ACATGCTGTGCCCCAAGTGTGTTCATAA GAACAAGATCTTGACTAAGAGCCTCGAAGGATAA
Translation
METAGDKK - UNI16649 - WSAEEPKEEVELQMSSQPSTAPAKAKATGKKQKKSETDNG - UNI14977 - GCKPKEGKPQDTETPGQTRRKVPI

PPIPEYLPPVNLIHRDVLRAWCQKKRVSSKGQ KLDAYKRLLARAFPEQM - UNI25370 - LELRNVPDSAKDARLKTAHKKMKTEPGEESEVTVPL

EMVPVPEEQIPALIDPPMLYEEVSTTVVTTPATEAVLASWARIASNAKKYEAVPADASSSSEVKG - UNI14914 - GGNVVCGSWDQPSWELAWLGS

AAV - UNI15171 - HAGQAWVPDKKGKAIALFLLPACTFPPPHLEDNMLCPKCVHK KNKILTKSLEG
Transcript ENSMUST00000050705
Sequence
GGAGATTTTGAAAAGCCGGCTGAGGTCAGAGGTCTTTTGGAAGCTGGGAGAACTTTCTTTCGGAGGATTCATCTATTCTCAAGATGGAGACTGCTGGAGA

CAAGAAG - UNI16649 - TGGAGCGCAGAAGAGCCGAAGGAAGAAGTGGAATTGCAGATGTCTAGTCAACCAAGCACGGCTCCTGCAAAGGCTAAAG

CAACGGGGAAAAAACAAAAGAAGTCGGAGACAGATAATG - UNI14977 - GTTGTAAACCAAAGGAGGGAAAACCACAAGACACTGAGACGCCAGGA

CAGACTCGTAGGAAG - UNI25370 - CTGGAGTTGAGGAACGTCCCTGACTCAGCCAAAGACGCCAGGTTGAAGACAGCTCACAAAAAAATGAAGAC

TGAACCGGGGGAGGAGTCTGAGGTGACAGTTCCTCTGGAAATGGTCCCTGTGCCAGAGGAGCAGATACCTGCCCTCATTGACCCTCCTATGCTCTATGAG

GAAGTCAGCACCACCGTAGTGACTACACCTGCCACTGAGGCCGTGTTAGCATCTTGGGCCAGAATTGCATCCAATGCTAAGAAGTACGAGGCAGTGCCAG

CCGATGCTTCGTCCTCATCAGAAGTCAAAG - UNI14914 - - UNI25370 - GGGAAATGTGGTGTGTGGTTCATGGGACCAGCCTTCCTGGGAA

CTCGCGTGGTTGGGTTCGGCTGCAGTTCCACGCTGGACAAGCCTGGGTACCCGATAAGAAAGGAAAAGCCATTGCCCTCTTCCTGCTTCCGGCCTGCACA

TTTCCACCCCCACACCTGGAGGACAACATGCTGTGCCCCAAGTGTGTTCATAA GAACAAGATCTTGACTAAGAGCCTCGAAGGATAAAGGACAGATCTC

TTGTTTGAGCTAGCTGCTGGCGTCACTCACTCTTGTGGTGTGATCAGCAGAGCTGCGGCTGACGCTGAGACTGATAGAAATCTACATCTCTGCCTTTGAA

GGTGCCTTTCTCATCCAGAACTTAAGGGATAGTGTAAGTTAGTTGATGCTTAAGTTCACGCAGTTTGAAAAAAGCCAGCGAGGCCACCTCTGCTCGCTGT

GATGACTGATCACTGAGAGTGAACTCTTACTCTTTTGTGAAGATAAAAATACATCCTATGTGTTTTGCTGCAAGTAGGTCCTGGGGCAGGAGGATGATAT

CTCCAGATAACAATAGTTGCTAGTCCTGTCACCAGCACAACGGGCGTCATAACCAGTTCAGCAGTCAACTGTAAAGACTTGGCTTATACCTGTAGCCTCC

GCATGCATGTCCTCTTCCCTGGGTTGTAGTGTGTTGTTAGTGTTTAATACTTGTGTTTGTTTTCTGCTGTTGTAAAATATTACACTAAATCTGGCTTGTG

GCTTTTGTTTTTGTTATCTGAATGGTTAAATTTCCCCTGAGTTCCTTC
Translation
METAGDKK - UNI16649 - WSAEEPKEEVELQMSSQPSTAPAKAKATGKKQKKSETDNG - UNI14977 - GCKPKEGKPQDTETPGQTRRK - 

UNI25370 - LELRNVPDSAKDARLKTAHKKMKTEPGEESEVTVPLEMVPVPEEQIPALIDPPMLYEEVSTTVVTTPATEAVLASWARIASNAKKYEAV

PADASSSSEVKG - UNI14914 - - UNI25370 - GEMWCVVHGTSLPGNSRGWVRLQFHAGQAWVPDKKGKAIALFLLPACTFPPPHLEDNMLCP

KCVHK KNKILTKSLEG
Transcript ENSMUST00000096045
Sequence
GGAGATTTTGAAAAGCCGGCTGAGGTCAGAGGTCTTTTGGAAGCTGGGAGAACTTTCTTTCGGAGGATTCATCTATTCTCAAGATGGAGACTGCTGGAGA

CAAGAAG - UNI16649 - TGGAGCGCAGAAGAGCCGAAGGAAGAAGTGGAATTGCAGATGTCTAGTCAACCAAGCACGGCTCCTGCAAAGGCTAAAG

CAACGGGGAAAAAACAAAAGAAGTCGGAGACAGATAATG - UNI14977 - GTTGTAAACCAAAGGAGGGAAAACCACAAGACACTGAGACGCCAGGA

CAGACTCGTAGGAAGGTACCAATTCCTCCTATTCCAGAGTATCTGCCCCCAGTGAACCTGATTCACCGAGATGTTTTGCGGGCATGGTGCCAGAAGAAAC

GAGTGAGCAGCAAAGGCCAG AAATTAGATGCTTATAAACGACTCCTTGCAAGGGCTTTCCCAGAACAAATG - UNI25370 - CTGGAGTTGAGGAA

CGTCCCTGACTCAGCCAAAGACGCCAGGTTGAAGACAGCTCACAAAAAAATGAAGACTGAACCGGGGGAGGAGTCTGAGGTGACAGTTCCTCTGGAAATG

GTCCCTGTGCCAGAGGAGCAGATACCTGCCCTCATTGACCCTCCTATGCTCTATGAGGAAGTCAGCACCACCGTAGTGACTACACCTGCCACTGAGGCCG

TGTTAGCATCTTGGGCCAGAATTGCATCCAATGCTAAGAAGTACGAGGCAGTGCCAGCCGATGCTTCGTCCTCATCAGAAGTCAAAG - UNI14914 -

 - UNI25370 - GGGAAATGTGGTGTGTGGTTCATGGGACCAGCCTTCCTGGGAACTCGCGTGGTTGGGTTCGGCTGCAGTTCCACGCTGGACAAGCC

TGGGTACCCGATAAGAAAGGAAAAGCCATTGCCCTCTTCCTGCTTCCGGCCTGCACATTTCCACCCCCACACCTGGAGGACAACATGCTGTGCCCCAAGT

GTGTTCATAA GAACAAGATCTTGACTAAGAGCCTCGAAGGATAAAGGACAGATCTCTTGTTTGAGCTAGCTGCTGGCGTCACTCACTCTTGTGGTGTGA

TCAGCAGAGCTGCGGCTGACGCTGAGACTGATAGAAATCTACATCTCTGCCTTTGAAGGTGCCTTTCTCATCCAGAACTTAAGGGATAGTGTAAGTTAGT

TGATGCTTAAGTTCACGCAGTTTGAAAAAAGCCAGCGAGGCCACCTCTGCTCGCTGTGATGACTGATCACTGAGAGTGAACTCTTACTCTTTTGTGAAGA

TAAAAATACATCCTATGTGTTTTGCTGCAAGTAGGTCCTGGGGCAGGAGGATGATATCTCCAGATAACAATAGTTGCTAGTCCTGTCACCAGCACAACGG

GCGTCATAACCAGTTCAGCAGTCAACTGTAAAGACTTGGCTTATACCTGTAGCCTCCGCATGCATGTCCTCTTCCCTGGGTTGTAGTGTGTTGTTAGTGT

TTAATACTTGTGTTTGTTTTCTGCTGTTGTAAAATATTACACTAAATCTGGCTTGTGGCTTTTGTTTTTGTTATCTGAATGGTTAAATTTCCCCTGAGTT

CCTTC
Translation
METAGDKK - UNI16649 - WSAEEPKEEVELQMSSQPSTAPAKAKATGKKQKKSETDNG - UNI14977 - GCKPKEGKPQDTETPGQTRRKVPI

PPIPEYLPPVNLIHRDVLRAWCQKKRVSSKGQ KLDAYKRLLARAFPEQM - UNI25370 - LELRNVPDSAKDARLKTAHKKMKTEPGEESEVTVPL

EMVPVPEEQIPALIDPPMLYEEVSTTVVTTPATEAVLASWARIASNAKKYEAVPADASSSSEVKG - UNI14914 - - UNI25370 - GEMWCVVH

GTSLPGNSRGWVRLQFHAGQAWVPDKKGKAIALFLLPACTFPPPHLEDNMLCPKCVHK KNKILTKSLEG

For any suggestions or comments, please send an email to unitrap@crg.es