Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000058626 (Capn11)
Chromosomal location
Chr 17: 45767153 - 45796274 (-)
Description
calpain 11 Gene [Source:MGI (curated);Acc:Capn11-001]
RefSeq_peptide
NP_001013789.1 
UniGene
Mm.426026 
MGI
MGI:1352490 
Uniprot/SPTREMBL
Q99MT5 Q6J756 
Human Ortholog
ENSG00000137225 (CAPN11)
Omim not available
UniTrap UNI33085
Vector Insertion
Chr 17: 45771216 - 45775820
Public Clones IST10346D1 (tigm) IST10571F12 (tigm) IST11777A4 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 63% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI23689
Vector Insertion
Chr 17: 45769882 - 45769988
Public Clones not available
Private Clones OST248992 (lexicon)
Severity of mutation (?) Insertion after 78% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI27509
Vector Insertion
Chr 17: 45769399 - 45769647
Public Clones not available
Private Clones OST57845 (lexicon)
Severity of mutation (?) Insertion after 84% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000076593
Sequence
CTCAATAG AACAGACATCTCTTGGGCTGAAAAAGGAATGGTGGCTACCATAAACCACTCCAGGCTCAAGGACAAGGGCGTGGGCCAACACCAAAATGCC

TACAACTATAAGAATCAGAACTATGAGGACCTTCGAGCAGAGTGTCTCAGGAAGGGGGAACTGTTCGAAGACCCCTTTTTCCCTGCTGAACCCAGGTCTA

TCGGTGTCAAGAACCTGGGCCCCAACTCTGAACACATGCAGAATATCTACTGGCAGCGGCCAAAG GATATCATTCATAACCCCCAGTTCATCACGAATG

ACTTCTCTCCCACGGACATCTGCCAAGGGATCCTGG GGGACTGCTGGCTCCTGGCTGCCATTGGCTCCCTTACCACCTGCCCCAAACTGCTGTACCGTG

TGGTGCCCAGAAATCAGAGCTTCAAGAAGAACTATGCTGGCATCTTCCACTTTCAG CTTTGGCAGTTTGGGCACTGGTTGAACGTGGTCGTGGACGACC

GGCTGCCCACTAGGAACAACAAGCTGGTATTCGTGCACGCCTCCCATCGCCAGGATTTCTGGAGCGCCCTGCTGGAGAAGGCCTACGCCAA GCTGATCG

GATCCTACGGAGCGCTGTCTGGAGGCAGCACTTTGGAGGGTTTGGAAGATTTCACAGGCGGCGTAGCACAGTGCATTCCGCTCCAGAAGCCCCCTGGCAA

CATGCTAAGGCTCCTCAAGAAAGCCCTGGAGAAGTCTTCCCTCATGGGCTGTTCCATTGAA GTCACAGACAATAGTGAAGTAGAAACCATGACACATAA

CATGCTGGTGCGAGGACATGCTTATGCAGTGACTGGCCTAGAGGAT GTCTACTACAGAGACAAGTTGGAAACTCTAATTCGGATCCAAAATCCTTGGGG

TCGGGTTGAATGGAATGGAGCCTGGAGTGACAA AGCCACAGAGTGGGAAGAGGTGAGCCCAGATGTTCGGGTACAGCTGCTACACAAGAAGGATGATGG

CGATTTCTG GATGTCCTATGAAGACTTCATGAGCAACTTTACACTGCTGGAGATCTGCAACCTCACCCCGGATGCCCTCAACACCTGGGATTACAAGAG

CCGCTGGCACTCCACCTTCTATGAGGGCAGCTGGCGAAGGGGAAGCACTGCAGGGGGCTGCAGAAACCACCCGG - UNI33085 - AGACGTTCTGGA

GCAACCCCCAGTTCAAGATCTCTCTCCCGGAAGTGGATGACCCAGAGGATGACTCTGAGAAAAACGAAATGGTTTGCACCTGTCTGGTGGCACTGATGCA

GAAGAACTGGAGACATGCTCGAGAGGGACCCCAGCTCCTCACCATAGGCTTTGTCATCTTCTCG - UNI33085 - GTCCCAAAGGAG - UNI3308

5 - TTTCAGAACCTCCGGGACATCCACCTTAAGAAAGACTTCTTCTTGAAATACCGGGACCACGGCTTTTCAGAGATCTTCATCAACTCGAGGGAGGTG

AACAGCCATCTCCGGCTGCCCCCGGGGGAATACGTCATTATCCCCTCCACCTATGAGCCCCATAAAGATGCTGACTTCCTGCTTCGGGTCTTCACGGAGA

AACACAGTGAGACCTG GTTGCTGGATGACGCCAACCGGTTTGAACATCTCCAAGAG GAGACTGTCACTGACAAGGATTTGGACAAGGATTCTCTTCAG

CTGTTTAAGATAATGGCAAACGAG - UNI23689 - GATGGCGAAGTGGATATGTATGCACTACACAAACTTCTCAACAGGATGACAGCTAAAT TAA

GGAACTTCAAGACGAAGGGCTTTAGCTTGGAAGTCTGTCGCCGGATGATCAACCTCCTGGAT - UNI27509 - AAAGATGGTTCTGGCAAGCTGGAG

CTTCATGAATTCCAGGTCCTGTGGAAAAAGATCAAGAAATGGACG GAAATCTTCAAAGAGTGTGATGAGGACCGCTCAGGGAACTTGAACTCCTATGAG

ATGCGCCTGGCAATAGAGAAAGCAG GCATCAAGATGAACAACAGAGTGACCGAGGTAGTCGTTGCCAGGTACTCGGATAACATGATTGTGGACTTTGAC

AGCTTCCTCAACTGTTTCCTGAGGCTCAAGGCCATGTTTG CGTTCTTCTTATCCATGGACACCAAGAAAACTGGTTCTATTTGCTTGGATATTAACCAG

 TGGCTGCAAATAACCATGTGGGGGTAGGGAGATGCGAAGCCTGGCTCCCTCGTTCCTCCCTCCGCCGGTGGCGCTCCTGCTCCGGCCAGGATGGTGGAT

GCTCCTTGTCGCTCTCGCTCTCCAGTGCCCCAGGCACAGTGTTTACTCTGGTCCCCTGATCCGGGCTGACCGGAACACCAACACCCCCCTCCCCCACCCC

CACCACGCCCCGAGCACTCTCACGCCGTATTTAGACTAAAAATGAGGTGGATTCTCCGCCAGTTTTTCTCTGGCGAAGGCAATCTTCAGCTTAAGTGTTC

CCGCGTGCTGTCAACTCACACCCGCCTCCTAGCCCGCCCTCTTGTCAGGAATTCCATCGCCTCCCCGCGCCGCGTCGTACACATTATTCTAATAAAGAGG

ACAAGGTT
Translation
LNR RTDISWAEKGMVATINHSRLKDKGVGQHQNAYNYKNQNYEDLRAECLRKGELFEDPFFPAEPRSIGVKNLGPNSEHMQNIYWQRPK DIIHNPQFI

TNDFSPTDICQGILG GDCWLLAAIGSLTTCPKLLYRVVPRNQSFKKNYAGIFHFQ LWQFGHWLNVVVDDRLPTRNNKLVFVHASHRQDFWSALLEKAY

AK KLIGSYGALSGGSTLEGLEDFTGGVAQCIPLQKPPGNMLRLLKKALEKSSLMGCSIE VTDNSEVETMTHNMLVRGHAYAVTGLED VYYRDKLETL

IRIQNPWGRVEWNGAWSDK KATEWEEVSPDVRVQLLHKKDDGDFW WMSYEDFMSNFTLLEICNLTPDALNTWDYKSRWHSTFYEGSWRRGSTAGGCRN

HPE - UNI33085 - ETFWSNPQFKISLPEVDDPEDDSEKNEMVCTCLVALMQKNWRHAREGPQLLTIGFVIFS - UNI33085 - VPKE - UNI

33085 - FQNLRDIHLKKDFFLKYRDHGFSEIFINSREVNSHLRLPPGEYVIIPSTYEPHKDADFLLRVFTEKHSETW WLLDDANRFEHLQE ETVTD

KDLDKDSLQLFKIMANE - UNI23689 - DGEVDMYALHKLLNRMTAKL LRNFKTKGFSLEVCRRMINLLD - UNI27509 - KDGSGKLELHEF

QVLWKKIKKWT EIFKECDEDRSGNLNSYEMRLAIEKAG GIKMNNRVTEVVVARYSDNMIVDFDSFLNCFLRLKAMFA AFFLSMDTKKTGSICLDINQ

 WLQITMWG
Transcript ENSMUST00000120717
Sequence
CAACTGTCAAGGACTGTGCTAGGTGCTAGCTGTTCTAGGTGTTCATCTGATAGATAGCCTTCAGGATGCTGAACTACTCAG ACATCTCTTGGGCTGAAA

AAGGAATGGTGGCTACCATAAACCACTCCAGGCTCAAGGACAAGGGCGTGGGCCAACACCAAAATGCCTACAACTATAAGAATCAGAACTATGAGGACCT

TCGAGCAGAGTGTCTCAGGAAGGGGGAACTGTTCGAAGACCCCTTTTTCCCTGCTGAACCCAGGTCTATCGGTGTCAAGAACCTGGGCCCCAACTCTGAA

CACATGCAGAATATCTACTGGCAGCGGCCAAAG GATATCATTCATAACCCCCAGTTCATCACGAATGACTTCTCTCCCACGGACATCTGCCAAGGGATC

CTGG GGGACTGCTGGCTCCTGGCTGCCATTGGCTCCCTTACCACCTGCCCCAAACTGCTGTACCGTGTGGTGCCCAGAAATCAGAGCTTCAAGAAGAAC

TATGCTGGCATCTTCCACTTTCAG CTTTGGCAGTTTGGGCACTGGTTGAACGTGGTCGTGGACGACCGGCTGCCCACTAGGAACAACAAGCTGGTATTC

GTGCACGCCTCCCATCGCCAGGATTTCTGGAGCGCCCTGCTGGAGAAGGCCTACGCCAA GCTGATCGGATCCTACGGAGCGCTGTCTGGAGGCAGCACT

TTGGAGGGTTTGGAAGATTTCACAGGCGGCGTAGCACAGTGCATTCCGCTCCAGAAGCCCCCTGGCAACATGCTAAGGCTCCTCAAGAAAGCCCTGGAGA

AGTCTTCCCTCATGGGCTGTTCCATTGAA GTCACAGACAATAGTGAAGTAGAAACCATGACACATAACATGCTGGTGCGAGGACATGCTTATGCAGTGA

CTGGCCTAGAGGAT GTCTACTACAGAGACAAGTTGGAAACTCTAATTCGGATCCAAAATCCTTGGGGTCGGGTTGAATGGAATGGAGCCTGGAGTGACA

A AGCCACAGAGTGGGAAGAGGTGAGCCCAGATGTTCGGGTACAGCTGCTACACAAGAAGGATGATGGCGATTTCTG GATGTCCTATGAAGACTTCATG

AGCAACTTTACACTGCTGGAGATCTGCAACCTCACCCCGGATGCCCTCAACACCTGGGATTACAAGAGCCGCTGGCACTCCACCTTCTATGAGGGCAGCT

GGCGAAGGGGAAGCACTGCAGGGGGCTGCAGAAACCACCCGG - UNI33085 - AGACGTTCTGGAGCAACCCCCAGTTCAAGATCTCTCTCCCGGAA

GTGGATGACCCAGAGGATGACTCTGAGAAAAACGAAATGGTTTGCACCTGTCTGGTGGCACTGATGCAGAAGAACTGGAGACATGCTCGAGAGGGACCCC

AGCTCCTCACCATAGGCTTTGTCATCTTCTCG - UNI33085 - GTCCCAAAGGAG - UNI33085 - TTTCAGAACCTCCGGGACATCCACCTTA

AGAAAGACTTCTTCTTGAAATACCGGGACCACGGCTTTTCAGAGATCTTCATCAACTCGAGGGAGGTGAACAGCCATCTCCGGCTGCCCCCGGGGGAATA

CGTCATTATCCCCTCCACCTATGAGCCCCATAAAGATGCTGACTTCCTGCTTCGGGTCTTCACGGAGAAACACAGTGAGACCTG GTTGCTGGATGACGC

CAACCGGTTTGAACATCTCCAAGAG GAGACTGTCACTGACAAGGATTTGGACAAGGATTCTCTTCAGCTGTTTAAGATAATGGCAAACGAG - UNI23

689 - GATGGCGAAGTGGATATGTATGCACTACACAAACTTCTCAACAGGATGACAGCTAAAT TAAGGAACTTCAAGACGAAGGGCTTTAGCTTGGAA

GTCTGTCGCCGGATGATCAACCTCCTGGAT - UNI27509 - AAAGATGGTTCTGGCAAGCTGGAGCTTCATGAATTCCAGGTCCTGTGGAAAAAGAT

CAAGAAATGGACG GAAATCTTCAAAGAGTGTGATGAGGACCGCTCAGGGAACTTGAACTCCTATGAGATGCGCCTGGCAATAGAGAAAGCAG GCATCA

AGATGAACAACAGAGTGACCGAGGTAGTCGTTGCCAGGTACTCGGATAACATGATTGTGGACTTTGACAGCTTCCTCAACTGTTTCCTGAGGCTCAAGGC

CATGTTTG CGTTCTTCTTATCCATGGACACCAAGAAAACTGGTTCTATTTGCTTGGATATTAACCAG TGGCTGCAAATAACCATGTGGGGGTAGGGAG

ATGCGAAGCCTGGCTCCCTCGTTCCTCCCTCCGCCGGTGGCGCTCCTGCTCCGGCCAGGATGGTGGATGCTCCTTGTCGCTCTCGCTCTCCAGTGCCCCA

GGCACAGTGTTTACTCTGGTCCCCTGATCCGGGCTGACCGGAACACCAACACCCCCCTCCCCCACCCCCACCACGCCCCGAGCACTCTCACGCCGTATTT

AGACTAAAAATGAGGTGGATTCTCCGCCAGTTTTTCTCTGGCGAAGGCAATCTTCAGCTTAAGTGTTCCCGCGTGCTGTCAACTCACACCCGCCTCCTAG

CCCGCCCTCTTGTCAGGAATTCCATCGCCTCCCCGCGCCGCGTCGTACACATTATTCTAATAAAGAGGACAAGGTTA
Translation
MLNYSD DISWAEKGMVATINHSRLKDKGVGQHQNAYNYKNQNYEDLRAECLRKGELFEDPFFPAEPRSIGVKNLGPNSEHMQNIYWQRPK DIIHNPQF

ITNDFSPTDICQGILG GDCWLLAAIGSLTTCPKLLYRVVPRNQSFKKNYAGIFHFQ LWQFGHWLNVVVDDRLPTRNNKLVFVHASHRQDFWSALLEKA

YAK KLIGSYGALSGGSTLEGLEDFTGGVAQCIPLQKPPGNMLRLLKKALEKSSLMGCSIE VTDNSEVETMTHNMLVRGHAYAVTGLED VYYRDKLET

LIRIQNPWGRVEWNGAWSDK KATEWEEVSPDVRVQLLHKKDDGDFW WMSYEDFMSNFTLLEICNLTPDALNTWDYKSRWHSTFYEGSWRRGSTAGGCR

NHPE - UNI33085 - ETFWSNPQFKISLPEVDDPEDDSEKNEMVCTCLVALMQKNWRHAREGPQLLTIGFVIFS - UNI33085 - VPKE - UN

I33085 - FQNLRDIHLKKDFFLKYRDHGFSEIFINSREVNSHLRLPPGEYVIIPSTYEPHKDADFLLRVFTEKHSETW WLLDDANRFEHLQE ETVT

DKDLDKDSLQLFKIMANE - UNI23689 - DGEVDMYALHKLLNRMTAKL LRNFKTKGFSLEVCRRMINLLD - UNI27509 - KDGSGKLELHE

FQVLWKKIKKWT EIFKECDEDRSGNLNSYEMRLAIEKAG GIKMNNRVTEVVVARYSDNMIVDFDSFLNCFLRLKAMFA AFFLSMDTKKTGSICLDIN

Q WLQITMWG

For any suggestions or comments, please send an email to unitrap@crg.es