Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000058638 (Zfp110)
Chromosomal location
Chr 7: 13420410 - 13435925 (+)
Description
zinc finger protein 110 Gene [Source:MGI (curated);Acc:Zfp110-001]
RefSeq_dna
NM_022981 
RefSeq_peptide
NP_075357.4 
UniGene
Mm.292297 Mm.392876 Mm.401974 
MGI
MGI:1890378 
Uniprot/SPTREMBL
Q8BS00 Q923B3 Q9D6I6 Q9QZ07 
Human Ortholog
ENSG00000171606 (ZNF274)
Omim not available
UniTrap UNI22613
Vector Insertion
Chr 7: 13420877 - 13421641
Public Clones not available
Private Clones OST290040 (lexicon)
Severity of mutation (?) Insertion after 2% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000004614
Sequence
GTGAAAGCCCGTCGGGGGCAGCACCCATCTTCTGTTTTATTTGCAACCTCTGGAACCCAGTGTCGGCTTCGTTTGTGGCGCCACTTCTACGGACCCGGGA

GAAG GTTTCGTCAGCATTCTGCCTACTCCTGGGAGAGAACATGGAGGACAGTATGGCTTCCACGCTTCCAACAACCTGGCCCCAT - UNI22613 - 

GAGTCTGTGAAGTTTGAAGATGTATCTCTGACGTTTACCGAGGAAGAGTGGGCACAGCTGGACTTCCAACAGAAGTGCCTGTACAGGGAGATCATGATGG

AGAACTACAGCAACATGATTTCAGTGG AGCATCACTTTTCAAAGCCAAATGTGATATCTCAGCTAGAAAAAGCCGAAGACTGCTGGCCAATGCAGAGAG

AAATTCCTCAAGATACTCTTCCAG AATGTTCTTGGCCTTCTCCAGACCCTGGAATGAATTCCTTTCCTTCTAAGAGTCCCCTGATGAAGATCGAGGTTG

TTGAGGTCCTTACATTGAACAAGGATGTGGCTGGTCCTCGGAATGCCCTGATTCAATCCCTCTATCCAGAAGACTTGAACCCAGGTAACCTCAAGCCAGC

TCAACAGCCAAGCAAGCGTTTGACTGACACTGAAGCTTCTCGCCAGAAGTTCCGACATTTCCAGTATGAAGAGTCAGCTGGTCCCCAGAAGGCTATGTCC

CAGCTTCGTAAGCTGTGTCACCAGTGGCTGCAGCCCAATACACGTTCAAAGAAGCAGATCCTAGAGTTGCTGGTGCTCGAGCAGTTCCTGAATGCACTGC

CTGAGAAGTTTCGGGTATGGGTAGAGTCGCAGCACCCAGAAGATTGCAAAGCAGTGGTGGCTTTGTTGGAGAATATGACCTCGGTGTCTAAGGACGATG 

CTTCGCTTGCCTGCTCCAGTGAGGCCACTGATCAACTAAAGGAGAAAAGGAAGGGTGTGGCCACCTTACCAGTTACTTTTGCAGCTGAGGTTCCAGCTGA

G GAGCCGGTGACTTTCCAGGATGTGGCTGTAGACTTCAATGAGGAGGAGTGGCGGCTACTAGGTCCAACGCAGAAGACTGAGTATCATGATGTGATGCT

AGAGACCTTGGGCAACTTGGTCTCTGTGG GGTGGGAGCCTACATTGGGAAACAGAGAGTTAACTCCAGACTCTCCCATTCCTGTGGTAAAACCAATTCA

TGACCCAAACACAAAAGATCTCTCAAGGAATGGTACCCAGTCTACTGTCTTTGAAAGTATCTTAGAAGATGGGGTCAAAGAAATGCACACCATAGAATCA

AATCAAGTGGGGAATCTACAGGAAAAAGGCCATCCTCAGAAGAAGTTCTCTGAAAGCTCCAAGTCTCAAGACCAAACTAGTCGTCACAAAAGCCAGGGCT

CACTCAATGAAGTTCTTCCTAGAAAGTATGTAAAAGTTAAGCAGAAGGGCACTGGAAAGAGGAAAGGCAGGACAAACACCATTTCCATGACACGAGGTTT

ACGCATAAGAAAACAGCAGAAGGACTCTGTGGAGTGGCAAGGCAGGAGTGGCAGCACTCCTGTGACACATGGCTCCTCCATAAAAAACCAGCAACAGGGT

TCTGAGCAGGGAAAACCTGGGACCAGTAGAGATCCCATTACACTTACTGTGCCTGCAAAAGTTTACCAGAAAGCCACTGGCTCTAAAGAGAGTATACTTA

TGGACAGTAGCGATGCCATGGTGTCTGATGTACCTCCAAAGATTCACCAGAAAGGCCCTGAATGGCATAAAGTTGGGGAAAGTAACAATTCCATGTTACA

AGGTTCATCTGTACAAAATCACCAGATGGAGTCTGGGGCAGGGAGAGCCAGTGACAACAGTCTCTTGACACATGCCTTACCTGTAAAAAGTCATCAGAAA

GGCTATAAAGAAGGAAACGTCCAAGGGAACAGGAATTCCTGGAAACATATAAAACCTCACCAGAAGGGTTCTAAAGGGGAAAGAGTCGAGGAACTTAGCA

CTTCTGAAAAACATGTCCCCTATGTAAAAAATCACCTAAAGACCTCGGAAAGAGGAAAAGACAGGGAAATCAATGCTTCCATAAAATGTGATCCCTATAT

AAAAACTTACTATAGAGGTTCTGATGTGGGAAGGCTCAGGAGAGCCAACAATTGTAGGAAAGCCTTCAGCCTGCATGCTCAGCAGATATCCTTTATAAAA

ATTCACAAGGGGAGCCAAGTTTGCCGATGTAGTGAATGTGGTAAACTGTTCCGGAATGCTAGGTATTTCTCTGTCCATAAGAAGATCCACACAGGAGAGC

GGCCATATATGTGTATGGCCTGTGGGAAAGCATTTGTTCAGAGCTCCTCCCTCACACAGCATCTTAGAATTCATAGTGGAGAGAGACCATTTGAGTGTTC

AGAGTGTGGGAGGACCTTCAACGACCGCTCAGCCATCTCTCAGCACCTGAGAACTCATACTGGAGCTAAGCCCTACCACTGTGAGCGCTGTGGGAAAGCT

TTCCGTCAGAGTTCCCACCTTACCAGGCATGAGAGAACTCATACTGGTGAGAGACCATATGTGTGCATCAAGTGTGGGAAGGCATTCACACAGAGCTCAC

ACCTTATTGGGCATCAGAAAACACATGGGATAAAATTCAAGAAGCAGCCCAAATTGTAGCCTTTGTGCCTTTCAAAGCACTATTTTTTTTTCAGCCTTGA

GATGTACTATGCAGACACTCAGTATGACAGATAGGCTTTGACTAAGGAGAGCCCCACACCTTAAGGACAGCTCAGGACACCACCTAGCAGGCAGTGAGTG

AAACCATCAGGGAGTTCTTAATTGCTTCATTTATCCTCAAAAGGAAATAAAATATCTGAAAATGCATCTAAGTTTAAGAAGTCAAGTACCAAAAATTGCA

CTGATATTTCTATACAGGATAAAATGTGTAAGTGAAAAAAAACTAAAAGTATATAGCTAAATAAGCTATTATATTTGTGTGGAACTTTTTTTTCTGCTGT

GATAGCTATTTTTTGTTATCAGTTTGACTACAACTGGAATTAAACTGATTTAAGCTGAATATACCTTTGAGGAATTTTTTTCTTAATCTGGATTGCACCT

TCTACTGGCAACCTATATAAAGGACATGGAAGAAAGAAGCTTGCCCTCTTTGCCTGTTTGCTCTCACTAGCTAGTCTATTCTTTCACTTGCATTAGAGCT

TACATACGGGTTCTGGCATCTATCACCTGAGACATCCTGCCTCGTGAACTGAACAACTACTGGATTTTTGGGGATTCTTAGACCTTCCACTAATAAACAG

CCATTGTCGT
Translation
 MEDSMASTLPTTWPH - UNI22613 - ESVKFEDVSLTFTEEEWAQLDFQQKCLYREIMMENYSNMISVE EHHFSKPNVISQLEKAEDCWPMQREI

PQDTLPE ECSWPSPDPGMNSFPSKSPLMKIEVVEVLTLNKDVAGPRNALIQSLYPEDLNPGNLKPAQQPSKRLTDTEASRQKFRHFQYEESAGPQKAMS

QLRKLCHQWLQPNTRSKKQILELLVLEQFLNALPEKFRVWVESQHPEDCKAVVALLENMTSVSKDDA ASLACSSEATDQLKEKRKGVATLPVTFAAEVP

AE EPVTFQDVAVDFNEEEWRLLGPTQKTEYHDVMLETLGNLVSVG GWEPTLGNRELTPDSPIPVVKPIHDPNTKDLSRNGTQSTVFESILEDGVKEMH

TIESNQVGNLQEKGHPQKKFSESSKSQDQTSRHKSQGSLNEVLPRKYVKVKQKGTGKRKGRTNTISMTRGLRIRKQQKDSVEWQGRSGSTPVTHGSSIKN

QQQGSEQGKPGTSRDPITLTVPAKVYQKATGSKESILMDSSDAMVSDVPPKIHQKGPEWHKVGESNNSMLQGSSVQNHQMESGAGRASDNSLLTHALPVK

SHQKGYKEGNVQGNRNSWKHIKPHQKGSKGERVEELSTSEKHVPYVKNHLKTSERGKDREINASIKCDPYIKTYYRGSDVGRLRRANNCRKAFSLHAQQI

SFIKIHKGSQVCRCSECGKLFRNARYFSVHKKIHTGERPYMCMACGKAFVQSSSLTQHLRIHSGERPFECSECGRTFNDRSAISQHLRTHTGAKPYHCER

CGKAFRQSSHLTRHERTHTGERPYVCIKCGKAFTQSSHLIGHQKTHGIKFKKQPKL

For any suggestions or comments, please send an email to unitrap@crg.es