Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000058709 (Egln2)
Chromosomal location
Chr 7: 27943678 - 27951774 (-)
Description
EGL nine homolog 2 (C. elegans) Gene [Source:MGI (curated);Acc:Egln2-001]
RefSeq_dna
NM_053208 
RefSeq_peptide
NP_444438.2 
UniGene
Mm.29978 
MGI
MGI:1932287 
Uniprot/SWISSPROT
Q91YE2 
Uniprot/SPTREMBL
Q3TXL8 Q3U8V5 Q80X29 
Human Ortholog
ENSG00000171570 (EGLN2)
Omim not available
UniTrap UNI24888
Vector Insertion
Chr 7: 27950748 - 27951334
Public Clones (sanger) IST14710F10 (tigm)
Private Clones OST202215 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI14623
Vector Insertion
Chr 7: 27949638 - 27951433
Public Clones FHCRC-GT-S5-10H1 (fhcrc)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI20311
Vector Insertion
Chr 7: 27944943 - 27945306
Public Clones not available
Private Clones OST367597 (lexicon) OST350500 (lexicon) OST326655 (lexicon) OST130844 (lexicon)
OST130758 (lexicon)
Severity of mutation (?) Insertion after 79% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000108382
Sequence
TGGCGGAGGGGGTTGGGAGGAAGGCAGTCGGGTCGGACTCTGCTCTCGGGCTCCCTTCCGTCAGTCCGTCCGTCTGGCAGGACCTCCCTTCCGGCTGG -

 UNI14623 - - UNI24888 - CCACCCCCATCAGTCCCTTCTCAAGCTCCTAGAGACAACTGTGGACTTGGGGACCAGCGAGCACCCCCAGAGCAC

TAGAGGAGCCCCTGCTGCCTGCCCTGCCTCACCCTGCCCCACACGAGGCCCAGCGGCCCCGGGCTGCATCAAGTGGAGGAGGAGGAGGCGGAGGAGGGTG

GCACCATGGGCCCGGGCCGTGCCCTCCATGCCCGGGGGATGAAGACACTGCTGCCATGGACAGCCCGTGCCAGCCGCAGGCCCTGAATCAAGCTCTCCCT

CAGTTGCCAGGGTCTGTGTCAGAGTCCTTGGAGTCTAGCCGAGCCAGAATGGGGGTGGAGAGTTACCTGCCCTGCCCTCTGCTCCCGGCCTATCACCGTC

CAGGAGCATCTGGGGAGGCCTCGGCTGGCAATGGGACCCCCAGAACCACAGCCACTGCTACTACGACCACTGCCAGTCCCCTGCGGGAGGGCTTTGGTGG

GCAGGATGGTGGTGAGCTTTGGCCACTGCAGAGTGAAGGTGCTGCTGCGTTGGTCACCAAGGAGTGCCAGCGACTGGCGGCCCAGGGTGCCCGGCCTGAG

GCCCCCAAACGGAAGTGGGCCAAGGATGGTGGGGATGCCCCTTCACCCAGCAAGCGACCGTGGGCCAGGCAAGAGAACCAGGAGGCCAAGGGGGAAAGTG

GTATGGGCTGTGACAGCGGTGCCAGCAACAGCAGCAGCAGCAGCAGCAACACTACCAGTAGCAGTGGCGAGGCAAGTGCTAGGCTGAGGGAGGAAGTCCA

GCCCTCTGCACCTGAGCGCCTGGCCCTGGACTATATTGTGCCTTGCATGCGGTACTATGGTATCTGTGTCAAGGACAACTTCTTGGGGGCAGTACTGGGT

GGCCGTGTGCTGGCTGAGGTGGAAGCCCTGAAGTGGGGCGGGCGTCTTCGTGATGGGCAACTAGTGAGCCAGCGGGCGATCCCACCGCGCAGCATTCGTG

GGGACCAGATTGCCTGGGTAGAAGGTCACGAGCCAGGCTGCCGGAGCATTGGTGCCCTCATGGCTCACGTGGACGCAGTAATCCGCCACTGTGCAGGGCG

GCTGGGCAACTACGTCATCAATGGGCGCACCAAG - UNI14623 - GCCATGGTGGCGTGTTATCCAGGCAATGGGCTCGGGTACGTGAGGCATGTTG

ACAATCCCCACGGCGATGGGCGCTGCATCACCTGTATCTATTACCTGAATCAGAACTGGGATGTTAAG - UNI20311 - GTGCATGGCGGCCTGCTG

CAGATCTTCCCCGAGGGTCGGCCAGTGGTAGCCAACATCGAGCCACTCTTTGACCGGTTGCTCATTTTCTGGTCTGACCGACGGAACCCACATGAGGTGA

AGCCAGCCTATGCCACCAG GTACGCCATCACTGTCTGGTATTTTGATGCCAAGGAACGGGCAGCAGCCAGAGACAAGTATCAGCTAG CATCGGGACAG

AAAGGTGTTCAAGTACCAGTATCACAGCCAACTACACCTACCTAATGGCCAGCCCCAGAGCTGCGTGGACCAGCAGCAGCTCCTGCCTCAGTGCCCGCTC

CTTTCCTGCCACTGCTGCTGCTTCTGGCTTGCCTCTGTACTGTGTGGTGTGGAGGGCACTAAGTATCACTGAGGAGCAACAAGGAGAGACCTCTGCTGCC

CCGTGAGCGAGCG
Translation
 - UNI14623 - - UNI24888 - MDSPCQPQALNQALPQLPGSVSESLESSRARMGVESYLPCPLLPAYHRPGASGEASAGNGTPRTTATATTTTA

SPLREGFGGQDGGELWPLQSEGAAALVTKECQRLAAQGARPEAPKRKWAKDGGDAPSPSKRPWARQENQEAKGESGMGCDSGASNSSSSSSNTTSSSGEA

SARLREEVQPSAPERLALDYIVPCMRYYGICVKDNFLGAVLGGRVLAEVEALKWGGRLRDGQLVSQRAIPPRSIRGDQIAWVEGHEPGCRSIGALMAHVD

AVIRHCAGRLGNYVINGRTK - UNI14623 - AMVACYPGNGLGYVRHVDNPHGDGRCITCIYYLNQNWDVK - UNI20311 - VHGGLLQIFPEG

RPVVANIEPLFDRLLIFWSDRRNPHEVKPAYATR RYAITVWYFDAKERAAARDKYQLA ASGQKGVQVPVSQPTTPT
Transcript ENSMUST00000080058
Sequence
GGGGTATGGCGCGCTGCGAAGCGCAGGGCGGCTGGCACAAACGGCGGCGCCGAGGCCGGAGGAAAAAGCTCG - UNI14623 - - UNI24888 - C

CACCCCCATCAGTCCCTTCTCAAGCTCCTAGAGACAACTGTGGACTTGGGGACCAGCGAGCACCCCCAGAGCACTAGAGGAGCCCCTGCTGCCTGCCCTG

CCTCACCCTGCCCCACACGAGGCCCAGCGGCCCCGGGCTGCATCAAGTGGAGGAGGAGGAGGCGGAGGAGGGTGGCACCATGGGCCCGGGCCGTGCCCTC

CATGCCCGGGGGATGAAGACACTGCTGCCATGGACAGCCCGTGCCAGCCGCAGGCCCTGAATCAAGCTCTCCCTCAGTTGCCAGGGTCTGTGTCAGAGTC

CTTGGAGTCTAGCCGAGCCAGAATGGGGGTGGAGAGTTACCTGCCCTGCCCTCTGCTCCCGGCCTATCACCGTCCAGGAGCATCTGGGGAGGCCTCGGCT

GGCAATGGGACCCCCAGAACCACAGCCACTGCTACTACGACCACTGCCAGTCCCCTGCGGGAGGGCTTTGGTGGGCAGGATGGTGGTGAGCTTTGGCCAC

TGCAGAGTGAAGGTGCTGCTGCGTTGGTCACCAAGGAGTGCCAGCGACTGGCGGCCCAGGGTGCCCGGCCTGAGGCCCCCAAACGGAAGTGGGCCAAGGA

TGGTGGGGATGCCCCTTCACCCAGCAAGCGACCGTGGGCCAGGCAAGAGAACCAGGAGGCCAAGGGGGAAAGTGGTATGGGCTGTGACAGCGGTGCCAGC

AACAGCAGCAGCAGCAGCAGCAACACTACCAGTAGCAGTGGCGAGGCAAGTGCTAGGCTGAGGGAGGAAGTCCAGCCCTCTGCACCTGAGCGCCTGGCCC

TGGACTATATTGTGCCTTGCATGCGGTACTATGGTATCTGTGTCAAGGACAACTTCTTGGGGGCAGTACTGGGTGGCCGTGTGCTGGCTGAGGTGGAAGC

CCTGAAGTGGGGCGGGCGTCTTCGTGATGGGCAACTAGTGAGCCAGCGGGCGATCCCACCGCGCAGCATTCGTGGGGACCAGATTGCCTGGGTAGAAGGT

CACGAGCCAGGCTGCCGGAGCATTGGTGCCCTCATGGCTCACGTGGACGCAGTAATCCGCCACTGTGCAGGGCGGCTGGGCAACTACGTCATCAATGGGC

GCACCAAG - UNI14623 - GCCATGGTGGCGTGTTATCCAGGCAATGGGCTCGGGTACGTGAGGCATGTTGACAATCCCCACGGCGATGGGCGCTGC

ATCACCTGTATCTATTACCTGAATCAGAACTGGGATGTTAAG - UNI20311 - GTGCATGGCGGCCTGCTGCAGATCTTCCCCGAGGGTCGGCCAGT

GGTAGCCAACATCGAGCCACTCTTTGACCGGTTGCTCATTTTCTGGTCTGACCGACGGAACCCACATGAGGTGAAGCCAGCCTATGCCACCAG GTACGC

CATCACTGTCTGGTATTTTGATGCCAAGGAACGGGCAGCAGCCAGAGACAAGTATCAGCTAG CATCGGGACAGAAAGGTGTTCAAGTACCAGTATCACA

GCCAACTACACCTACCTAATGGCCAGCCCCAGAGCTGCGTGGACCAGCAGCAGCTCCTGCCTCAGTGCCCGCTCCTTTCCTGCCACTGCTGCTGCTTCTG

GCTTGCCTCTGTACTGTGTGGTGTGGAGGGCACTAAGTATCACTGAGGAGCAACAAGGAGAGACCTCTGCTGCCCCGTGAGCGAGCGGTGCTGGGTTTTG

ACCTGGGCAGTGGCCAGTGTGGCTGGCGGTCATGACTGGTGGCTGTGTCTGGTCCGTTGAGTGTAGAGCTGAGAAGAGGCAGGATTTGGGGTTGAGGTGA

GTCATGGCCTCTTGCTGGAAAGGTGTGTTGGGGTGTGGGTGTCATCTCACCCTCGTCCCCACTCCTCCGGCCTGGAATGTGAAGTGACTCCCCAGCCCCT

TTGGCTGTGGCAGTGTATGGACTGGGCTGCCACTGTCTGGGCAGAGTAGGGTGCCATGACGAGCATGGGTATGGAGGTTCTGCCAGCCAAGAAATAAAAG

TTTACCTCAGAGCTGC
Translation
 - UNI14623 - - UNI24888 - MDSPCQPQALNQALPQLPGSVSESLESSRARMGVESYLPCPLLPAYHRPGASGEASAGNGTPRTTATATTTTA

SPLREGFGGQDGGELWPLQSEGAAALVTKECQRLAAQGARPEAPKRKWAKDGGDAPSPSKRPWARQENQEAKGESGMGCDSGASNSSSSSSNTTSSSGEA

SARLREEVQPSAPERLALDYIVPCMRYYGICVKDNFLGAVLGGRVLAEVEALKWGGRLRDGQLVSQRAIPPRSIRGDQIAWVEGHEPGCRSIGALMAHVD

AVIRHCAGRLGNYVINGRTK - UNI14623 - AMVACYPGNGLGYVRHVDNPHGDGRCITCIYYLNQNWDVK - UNI20311 - VHGGLLQIFPEG

RPVVANIEPLFDRLLIFWSDRRNPHEVKPAYATR RYAITVWYFDAKERAAARDKYQLA ASGQKGVQVPVSQPTTPT

For any suggestions or comments, please send an email to unitrap@crg.es